PDB entry 5glw

View 5glw on RCSB PDB site
Description: Tl-gal with LacNAc
Class: sugar binding protein
Keywords: Carbohydrates, Tl-galectin, Anti-inflammation, SUGAR BINDING PROTEIN
Deposited on 2016-07-12, released 2016-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin
    Species: Toxascaris leonina [TaxId:59264]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GLW (Start-283)
    Domains in SCOPe 2.07: d5glwa1, d5glwa2, d5glwa3
  • Chain 'B':
    Compound: galectin
    Species: Toxascaris leonina [TaxId:59264]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GLW (Start-283)
    Domains in SCOPe 2.07: d5glwb1, d5glwb2, d5glwb3
  • Heterogens: GAL, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5glwA (A:)
    hhhhhhmatetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndv
    plhisvrfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevk
    eyehrvplssvthfsvdgdilityihwggkyypvpyesglagdglapgksllifatpekk
    gkrfhinllkkngdialhfnprfdekaivrnslisgewgneeregknplekgigcdlefr
    neeyafqiyvdgerfatyahrldphdinglqiggdvevtgiqmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5glwA (A:)
    matetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndvplhisv
    rfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevkeyehrv
    plssvthfsvdgdilityihwggkyypvpyesglagdglapgksllifatpekkgkrfhi
    nllkkngdialhfnprfdekaivrnslisgewgneeregknplekgigcdlefrneeyaf
    qiyvdgerfatyahrldphdinglqiggdvevtgiqmv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5glwB (B:)
    hhhhhhmatetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndv
    plhisvrfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevk
    eyehrvplssvthfsvdgdilityihwggkyypvpyesglagdglapgksllifatpekk
    gkrfhinllkkngdialhfnprfdekaivrnslisgewgneeregknplekgigcdlefr
    neeyafqiyvdgerfatyahrldphdinglqiggdvevtgiqmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5glwB (B:)
    matetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndvplhisv
    rfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevkeyehrv
    plssvthfsvdgdilityihwggkyypvpyesglagdglapgksllifatpekkgkrfhi
    nllkkngdialhfnprfdekaivrnslisgewgneeregknplekgigcdlefrneeyaf
    qiyvdgerfatyahrldphdinglqiggdvevtgiqmv