PDB entry 5glv

View 5glv on RCSB PDB site
Description: Tl-gal
Class: sugar binding protein
Keywords: Crystal Structures, Carbohydrates, Toxascaris leonina, Galectin, SUGAR BINDING PROTEIN
Deposited on 2016-07-12, released 2016-11-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin
    Species: Toxascaris leonina [TaxId:59264]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GLV (Start-283)
    Domains in SCOPe 2.06: d5glva1, d5glva2, d5glva3
  • Chain 'B':
    Compound: galectin
    Species: Toxascaris leonina [TaxId:59264]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GLV (Start-283)
    Domains in SCOPe 2.06: d5glvb1, d5glvb2, d5glvb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5glvA (A:)
    hhhhhhmatetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndv
    plhisvrfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevk
    eyehrvplssvthfsvdgdilityihwggkyypvpyesglagdglapgksllifatpekk
    gkrfhinllkkngdialhfnprfdekaivrnslisgewgneeregknplekgigcdlefr
    neeyafqiyvdgerfatyahrldphdinglqiggdvevtgiqmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5glvA (A:)
    matetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndvplhisv
    rfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevkeyehrv
    plssvthfsvdgdilityihwggkyypvpyesglagdglapgksllifatpekkgkrfhi
    nllkkngdialhfnprfdekaivrnslisgewgneeregknplekgigcdlefrneeyaf
    qiyvdgerfatyahrldphdinglqiggdvevtgiqmv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5glvB (B:)
    hhhhhhmatetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndv
    plhisvrfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevk
    eyehrvplssvthfsvdgdilityihwggkyypvpyesglagdglapgksllifatpekk
    gkrfhinllkkngdialhfnprfdekaivrnslisgewgneeregknplekgigcdlefr
    neeyafqiyvdgerfatyahrldphdinglqiggdvevtgiqmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5glvB (B:)
    matetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndvplhisv
    rfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevkeyehrv
    plssvthfsvdgdilityihwggkyypvpyesglagdglapgksllifatpekkgkrfhi
    nllkkngdialhfnprfdekaivrnslisgewgneeregknplekgigcdlefrneeyaf
    qiyvdgerfatyahrldphdinglqiggdvevtgiqmv