PDB entry 5glu

View 5glu on RCSB PDB site
Description: Tl-gal with SiaLac
Class: sugar binding protein
Keywords: Carbohydrates, Tl-galectin, Anti-inflammation, SUGAR BINDING PROTEIN
Deposited on 2016-07-12, released 2016-11-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin
    Species: Toxascaris leonina [TaxId:59264]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GLU (Start-283)
    Domains in SCOPe 2.06: d5glua1, d5glua2, d5glua3
  • Chain 'B':
    Compound: galectin
    Species: Toxascaris leonina [TaxId:59264]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GLU (Start-283)
    Domains in SCOPe 2.06: d5glub1, d5glub2, d5glub3
  • Heterogens: SIA, GAL, GLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gluA (A:)
    hhhhhhmatetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndv
    plhisvrfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevk
    eyehrvplssvthfsvdgdilityihwggkyypvpyesglagdglapgksllifatpekk
    gkrfhinllkkngdialhfnprfdekaivrnslisgewgneeregknplekgigcdlefr
    neeyafqiyvdgerfatyahrldphdinglqiggdvevtgiqmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gluA (A:)
    matetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndvplhisv
    rfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevkeyehrv
    plssvthfsvdgdilityihwggkyypvpyesglagdglapgksllifatpekkgkrfhi
    nllkkngdialhfnprfdekaivrnslisgewgneeregknplekgigcdlefrneeyaf
    qiyvdgerfatyahrldphdinglqiggdvevtgiqmv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gluB (B:)
    hhhhhhmatetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndv
    plhisvrfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevk
    eyehrvplssvthfsvdgdilityihwggkyypvpyesglagdglapgksllifatpekk
    gkrfhinllkkngdialhfnprfdekaivrnslisgewgneeregknplekgigcdlefr
    neeyafqiyvdgerfatyahrldphdinglqiggdvevtgiqmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gluB (B:)
    matetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndvplhisv
    rfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevkeyehrv
    plssvthfsvdgdilityihwggkyypvpyesglagdglapgksllifatpekkgkrfhi
    nllkkngdialhfnprfdekaivrnslisgewgneeregknplekgigcdlefrneeyaf
    qiyvdgerfatyahrldphdinglqiggdvevtgiqmv