PDB entry 5glt

View 5glt on RCSB PDB site
Description: Tl-gal with LNT
Class: sugar binding protein
Keywords: Crystal Structures, Carbohydrates, Tl-galectin, Anti-inflammation, SUGAR BINDING PROTEIN
Deposited on 2016-07-12, released 2016-11-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin
    Species: Toxascaris leonina [TaxId:59264]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GLT (Start-283)
    Domains in SCOPe 2.06: d5glta1, d5glta2, d5glta3
  • Chain 'B':
    Compound: galectin
    Species: Toxascaris leonina [TaxId:59264]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5GLT (Start-283)
    Domains in SCOPe 2.06: d5gltb1, d5gltb2, d5gltb3
  • Heterogens: BGC, GAL, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gltA (A:)
    hhhhhhmatetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndv
    plhisvrfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevk
    eyehrvplssvthfsvdgdilityihwggkyypvpyesglagdglapgksllifatpekk
    gkrfhinllkkngdialhfnprfdekaivrnslisgewgneeregknplekgigcdlefr
    neeyafqiyvdgerfatyahrldphdinglqiggdvevtgiqmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gltA (A:)
    matetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndvplhisv
    rfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevkeyehrv
    plssvthfsvdgdilityihwggkyypvpyesglagdglapgksllifatpekkgkrfhi
    nllkkngdialhfnprfdekaivrnslisgewgneeregknplekgigcdlefrneeyaf
    qiyvdgerfatyahrldphdinglqiggdvevtgiqmv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gltB (B:)
    hhhhhhmatetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndv
    plhisvrfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevk
    eyehrvplssvthfsvdgdilityihwggkyypvpyesglagdglapgksllifatpekk
    gkrfhinllkkngdialhfnprfdekaivrnslisgewgneeregknplekgigcdlefr
    neeyafqiyvdgerfatyahrldphdinglqiggdvevtgiqmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gltB (B:)
    matetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndvplhisv
    rfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevkeyehrv
    plssvthfsvdgdilityihwggkyypvpyesglagdglapgksllifatpekkgkrfhi
    nllkkngdialhfnprfdekaivrnslisgewgneeregknplekgigcdlefrneeyaf
    qiyvdgerfatyahrldphdinglqiggdvevtgiqmv