PDB entry 5gls

View 5gls on RCSB PDB site
Description: structure of bovine lactoperoxidase with a partially modified covalent bond with heme moiety
Deposited on 2016-07-12, released 2016-07-27
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lactoperoxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80025 (0-594)
      • conflict (253)
      • conflict (409)
      • conflict (546)
  • Heterogens: NAG, CA, HEM, SCN, IOD, OSM, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5glsA (A:)
    swevgcgapvplvkcdenspyrtitgdcnnrrspalgaanralarwlpaeyedglalpfg
    wtqrktrngfrvplarevsnkivgyldeegvldqnrsllfmqwgqivdhdldfapetelg
    snehsktqceeyciqgdncfpimfpkndpklktqgkcmpffragfvcptppyqslareqi
    navtsfldaslvygsepslasrlrnlssplglmavnqeawdhglaylpfnnkkpspcefi
    nttarvpcflagdsraseqillatahtlllrehnrlarelkklnphwngeklyqearkil
    gafiqiitfrdylpivlgsemqkwippyqgynnsvdprisnvftfafrfghmevpstvsr
    ldenyqpwgpeaelplhtlffntwriikdggidplvrgllakksklmnqkkmvtselrnk
    lfqpthkihgfdlaainlqrcrdhgmpgynswrgfcglsqpktlkglqtvlknkilakkl
    mdlyktpdnidiwiggnaepmvergrvgpllacllgrqfqqirdgdrfwwenpgvftekq
    rdslqkmsfsrlicdnthitkvplhafqannyphdfvdcstvdkldlspwasren