PDB entry 5glp

View 5glp on RCSB PDB site
Description: crystal structure of coxyl43, gh43 beta-xylosidase/alpha- arabinofuranosidase from a compostmicrobial metagenome in complex with l-arabinose, calcium-bound form
Deposited on 2016-07-12, released 2017-03-15
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoside hydrolase family 43
    Species: Uncultured bacterium [TaxId:77133]
    Gene: coxyl43
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0H5BL38 (21-343)
      • expression tag (14-20)
  • Chain 'B':
    Compound: Glycoside hydrolase family 43
    Species: Uncultured bacterium [TaxId:77133]
    Gene: coxyl43
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0H5BL38 (21-343)
      • expression tag (19-20)
  • Heterogens: CA, NA, ARA, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5glpA (A:)
    mgsshhhhhhssglvprgshmeplvthiytadpsahvfdgkvyiypshdidagtpendmg
    dhfdmrdyhvlsmnsipgevtdhgvaldikdipwagrqlwapdaaskdgkyylyfpakdk
    edifrigvavsdspagpfkpesepikgsysidpavfkdddgkyymyfggiwggqlqrwtt
    geyaghdasktdleqddapaigprialmsddmlsfaepvkeisivdeqgnpilggdhdrr
    ffeaawmhkyngtyylsystgdthyivyatgdnpygpftyrgvilnpvigwtnhhsivef
    ngkwylfyhdsslsggkthlrcikvtelthnadgtietispyie
    

    Sequence, based on observed residues (ATOM records):
    >5glpA (A:)
    vprgshmeplvthiytadpsahvfdgkvyiypshdidagtpendmgdhfdmrdyhvlsmn
    sipgevtdhgvaldikdipwagrqlwapdaaskdgkyylyfpakdkedifrigvavsdsp
    agpfkpesepikgsysidpavfkdddgkyymyfggiwggqlqrwttgeyaghdasktdle
    qddapaigprialmsddmlsfaepvkeisivdeqgnpilggdhdrrffeaawmhkyngty
    ylsystgdthyivyatgdnpygpftyrgvilnpvigwtnhhsivefngkwylfyhdssls
    ggkthlrcikvtelthnadgtietispyie
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5glpB (B:)
    mgsshhhhhhssglvprgshmeplvthiytadpsahvfdgkvyiypshdidagtpendmg
    dhfdmrdyhvlsmnsipgevtdhgvaldikdipwagrqlwapdaaskdgkyylyfpakdk
    edifrigvavsdspagpfkpesepikgsysidpavfkdddgkyymyfggiwggqlqrwtt
    geyaghdasktdleqddapaigprialmsddmlsfaepvkeisivdeqgnpilggdhdrr
    ffeaawmhkyngtyylsystgdthyivyatgdnpygpftyrgvilnpvigwtnhhsivef
    ngkwylfyhdsslsggkthlrcikvtelthnadgtietispyie
    

    Sequence, based on observed residues (ATOM records):
    >5glpB (B:)
    hmeplvthiytadpsahvfdgkvyiypshdidagtpendmgdhfdmrdyhvlsmnsipge
    vtdhgvaldikdipwagrqlwapdaaskdgkyylyfpakdkedifrigvavsdspagpfk
    pesepikgsysidpavfkdddgkyymyfggiwggqlqrwttgeyaghdasktdleqddap
    aigprialmsddmlsfaepvkeisivdeqgnpilggdhdrrffeaawmhkyngtyylsys
    tgdthyivyatgdnpygpftyrgvilnpvigwtnhhsivefngkwylfyhdsslsggkth
    lrcikvtelthnadgtietispyie