PDB entry 5glg

View 5glg on RCSB PDB site
Description: the novel function of osm1 under anaerobic condition in the er was revealed by crystal structure of osm1, a soluble fumarate reductase in yeast
Deposited on 2016-07-11, released 2017-07-12
The last revision was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fumarate reductase 2
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: OSM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21375 (1-470)
      • expression tag (0)
  • Heterogens: SIN, FAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5glgA (A:)
    asmkqpvvvigsglaglttsnrliskyripvvlldkaasiggnsikassgingahtdtqq
    nlkvmdtpelflkdtlhsakgrgvpslmdkltkesksairwlqtefdlkldllaqlgghs
    vprthrssgklppgfeivqalskklkdisskdsnlvqimlnsevvdieldnqghvtgvvy
    mdengnrkimkshhvvfcsggfgyskemlkeyspnlihlpttngkqttgdgqkilsklga
    elidmdqvqvhptgfidpndrennwkflaaealrglggillhpttgrrftnelstrdtvt
    meiqskcpkndnrallvmsdkvyenytnninfymsknlikkvsindlirqydlqttasel
    vtelksysdvntkdtfdrpliinafdkdistestvyvgevtpvvhftmggvkineksqvi
    kknsesvlsngifaagevsggvhganrlggssllecvvfgktaadniakly