PDB entry 5glc

View 5glc on RCSB PDB site
Description: crystal structure of the class a beta-lactamase penl-ttr11 containing 20 residues insertion in omega-loop
Deposited on 2016-07-10, released 2017-02-15
The last revision was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Burkholderia thailandensis [TaxId:57975]
    Gene: A8H35_31635
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2Z4SUB5 (4-287)
      • expression tag (0-3)
      • insertion (171)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5glcA (A:)
    gshmrnvaaeqqlrelestfdgrlgfvaldtatgariahraderfpfcstfktmlsaavl
    arsagdaallqrripyakrdlvryspitekhvgagmtvaelcaatlqysdntaanllial
    lggpqavtayarsigdatfrldrretelntaipgderdtttpaamaasvrrlpgderdtt
    tpaamaasvrrllvgdalgtaqraqlnawmlgnktgdariragvpagwrvadktgtgdyg
    tgndigvayppdrapivfvvyttmrsrnaqarddviasaariaarafv
    

    Sequence, based on observed residues (ATOM records):
    >5glcA (A:)
    gshmrnvaaeqqlrelestfdgrlgfvaldtatgariahraderfpfcstfktmlsaavl
    arsagdaallqrripyakrdlvryspitekhvgagmtvaelcaatlqysdntaanllial
    lggpqavtayarsigdatfrldlpgderdtttpaamaasvrrllvgdalgtaqraqlnaw
    mlgnktgdariragvpagwrvadktgtgdygtgndigvayppdrapivfvvyttmrsrna
    qarddviasaariaarafv