PDB entry 5gl8

View 5gl8 on RCSB PDB site
Description: The crystal structure of Nattokinase fragments
Class: hydrolase
Keywords: frinolytic enzymes, HYDROLASE
Deposited on 2016-07-10, released 2017-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Subtilisin NAT
    Species: Bacillus subtilis subsp. natto [TaxId:86029]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35835 (0-274)
      • engineered mutation (129)
    Domains in SCOPe 2.07: d5gl8a_
  • Chain 'B':
    Compound: Subtilisin NAT
    Species: Bacillus subtilis subsp. natto [TaxId:86029]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35835 (0-274)
      • engineered mutation (129)
    Domains in SCOPe 2.07: d5gl8b_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gl8A (A:)
    aqsvpygisqikapalhsqgytgsnvkvavidsgidsshpdlnvrggasfvpsetnpyqd
    gsshgthvagtiaalnnsigvlgvapsaslyavkvldstgsgqyswiingiewaisnnmd
    vinmslggpsgstalktvvdkavssgivvaaaagnegssgststvgypakypstiavgav
    nssnqrasfssvgseldvmapgvsiqstlpggtygayngtsmatphvagaaalilskhpt
    wtnaqvrdrlestatylgnsfyygkglinvqaaaq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gl8B (B:)
    aqsvpygisqikapalhsqgytgsnvkvavidsgidsshpdlnvrggasfvpsetnpyqd
    gsshgthvagtiaalnnsigvlgvapsaslyavkvldstgsgqyswiingiewaisnnmd
    vinmslggpsgstalktvvdkavssgivvaaaagnegssgststvgypakypstiavgav
    nssnqrasfssvgseldvmapgvsiqstlpggtygayngtsmatphvagaaalilskhpt
    wtnaqvrdrlestatylgnsfyygkglinvqaaaq