PDB entry 5gl3

View 5gl3 on RCSB PDB site
Description: crystal structure of ton_0340 in complex with mg
Deposited on 2016-07-07, released 2016-12-14
The last revision was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Thermococcus onnurineus NA1 [TaxId:523850]
    Gene: TON_0340
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6YTD8 (0-267)
      • expression tag (268)
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Thermococcus onnurineus NA1 [TaxId:523850]
    Gene: TON_0340
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6YTD8 (Start-267)
      • expression tag (268)
  • Chain 'C':
    Compound: Uncharacterized protein
    Species: Thermococcus onnurineus NA1 [TaxId:523850]
    Gene: TON_0340
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6YTD8 (Start-267)
      • expression tag (268)
  • Chain 'D':
    Compound: Uncharacterized protein
    Species: Thermococcus onnurineus NA1 [TaxId:523850]
    Gene: TON_0340
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6YTD8 (0-267)
      • expression tag (268)
  • Chain 'E':
    Compound: Uncharacterized protein
    Species: Thermococcus onnurineus NA1 [TaxId:523850]
    Gene: TON_0340
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6YTD8 (0-267)
      • expression tag (268)
  • Chain 'F':
    Compound: Uncharacterized protein
    Species: Thermococcus onnurineus NA1 [TaxId:523850]
    Gene: TON_0340
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6YTD8 (0-267)
      • expression tag (268)
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5gl3A (A:)
    miahlintdignrgvlkvyldyrrknfnflhnstkmfldnlervlivtgfpippmmvaet
    dgppgalaiyravemlggkaeiltysevekalepfgvslartpepedysliisvetpgra
    adgryysmsaleikrdpldgiflkaralgiptigvgdggneigmgkirelvvghvphgek
    iasvvetdelivsavsnwgayglvaqasievgrnllegwderrvieaissaglidgvskt
    lapsvdgirlmvhegivellkavvdeail
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gl3B (B:)
    miahlintdignrgvlkvyldyrrknfnflhnstkmfldnlervlivtgfpippmmvaet
    dgppgalaiyravemlggkaeiltysevekalepfgvslartpepedysliisvetpgra
    adgryysmsaleikrdpldgiflkaralgiptigvgdggneigmgkirelvvghvphgek
    iasvvetdelivsavsnwgayglvaqasievgrnllegwderrvieaissaglidgvskt
    lapsvdgirlmvhegivellkavvdeail
    

    Sequence, based on observed residues (ATOM records):
    >5gl3B (B:)
    iahlivlkvyldyrrknfnflhnstkmfldnlervlivtgfpippmmvaetdgppgalai
    yravemlggkaeiltysevekalepfgvslartpepedysliisvetpgraadgryysms
    aleikrdpldgiflkaralgiptigvgdggneigmgkirelvvghvphgekiasvvetde
    livsavsnwgayglvaqasievgrnllegwderrvieaissaglidgvsktlapsvdgir
    lmvhegivellkavvdeail
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5gl3C (C:)
    miahlintdignrgvlkvyldyrrknfnflhnstkmfldnlervlivtgfpippmmvaet
    dgppgalaiyravemlggkaeiltysevekalepfgvslartpepedysliisvetpgra
    adgryysmsaleikrdpldgiflkaralgiptigvgdggneigmgkirelvvghvphgek
    iasvvetdelivsavsnwgayglvaqasievgrnllegwderrvieaissaglidgvskt
    lapsvdgirlmvhegivellkavvdeail
    

    Sequence, based on observed residues (ATOM records):
    >5gl3C (C:)
    iahlintdignrgvlkvyldyrrknfnflhnstkmfldnlervlivtgfpippmmvaetd
    gppgalaiyravemlggkaeiltysevekalepfgvslartpepedysliisvetpgraa
    dgryysmsaleikrdpldgiflkaralgiptigvgdggneigmgkirelvvghvphgeki
    asvvetdelivsavsnwgayglvaqasievgrnllegwderrvieaissaglidgvsktl
    apsvdgirlmvhegivellkavvdeail
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >5gl3D (D:)
    miahlintdignrgvlkvyldyrrknfnflhnstkmfldnlervlivtgfpippmmvaet
    dgppgalaiyravemlggkaeiltysevekalepfgvslartpepedysliisvetpgra
    adgryysmsaleikrdpldgiflkaralgiptigvgdggneigmgkirelvvghvphgek
    iasvvetdelivsavsnwgayglvaqasievgrnllegwderrvieaissaglidgvskt
    lapsvdgirlmvhegivellkavvdeail
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >5gl3E (E:)
    miahlintdignrgvlkvyldyrrknfnflhnstkmfldnlervlivtgfpippmmvaet
    dgppgalaiyravemlggkaeiltysevekalepfgvslartpepedysliisvetpgra
    adgryysmsaleikrdpldgiflkaralgiptigvgdggneigmgkirelvvghvphgek
    iasvvetdelivsavsnwgayglvaqasievgrnllegwderrvieaissaglidgvskt
    lapsvdgirlmvhegivellkavvdeail
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >5gl3F (F:)
    miahlintdignrgvlkvyldyrrknfnflhnstkmfldnlervlivtgfpippmmvaet
    dgppgalaiyravemlggkaeiltysevekalepfgvslartpepedysliisvetpgra
    adgryysmsaleikrdpldgiflkaralgiptigvgdggneigmgkirelvvghvphgek
    iasvvetdelivsavsnwgayglvaqasievgrnllegwderrvieaissaglidgvskt
    lapsvdgirlmvhegivellkavvdeail