PDB entry 5gkn

View 5gkn on RCSB PDB site
Description: catalase structure determined by electron crystallography of thin 3d crystals
Deposited on 2016-07-04, released 2016-10-26
The last revision was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: ELECTRONCRYSTALLOGRAPHY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: catalase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: catalase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: catalase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HEM, NDP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gknA (A:)
    madnrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftde
    mahfdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvages
    gsadtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpd
    mvwdfwslrpeslhqvsflfsdrgipdghrhmngygshtfklvnangeavyckfhyktdq
    giknlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdlt
    kvwphgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypd
    thrhrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsale
    hrthfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavk
    nfsdvhpeygsriqalldkyneekpknavhtyvqhgshlsarekanl
    

    Sequence, based on observed residues (ATOM records):
    >5gknA (A:)
    nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
    fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
    dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
    dfwslrpeslhqvsflfsdrgipdghrhmngygshtfklvnangeavyckfhyktdqgik
    nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
    phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
    hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
    hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
    dvhpeygsriqalldkyne
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gknB (B:)
    madnrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftde
    mahfdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvages
    gsadtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpd
    mvwdfwslrpeslhqvsflfsdrgipdghrhmngygshtfklvnangeavyckfhyktdq
    giknlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdlt
    kvwphgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypd
    thrhrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsale
    hrthfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavk
    nfsdvhpeygsriqalldkyneekpknavhtyvqhgshlsarekanl
    

    Sequence, based on observed residues (ATOM records):
    >5gknB (B:)
    nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
    fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
    dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
    dfwslrpeslhqvsflfsdrgipdghrhmngygshtfklvnangeavyckfhyktdqgik
    nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
    phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
    hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
    hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
    dvhpeygsriqalldkyne
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5gknC (C:)
    madnrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftde
    mahfdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvages
    gsadtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpd
    mvwdfwslrpeslhqvsflfsdrgipdghrhmngygshtfklvnangeavyckfhyktdq
    giknlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdlt
    kvwphgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypd
    thrhrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsale
    hrthfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavk
    nfsdvhpeygsriqalldkyneekpknavhtyvqhgshlsarekanl
    

    Sequence, based on observed residues (ATOM records):
    >5gknC (C:)
    nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
    fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
    dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
    dfwslrpeslhqvsflfsdrgipdghrhmngygshtfklvnangeavyckfhyktdqgik
    nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
    phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
    hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
    hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
    dvhpeygsriqalldkyne
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5gknD (D:)
    madnrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftde
    mahfdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvages
    gsadtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpd
    mvwdfwslrpeslhqvsflfsdrgipdghrhmngygshtfklvnangeavyckfhyktdq
    giknlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdlt
    kvwphgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypd
    thrhrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsale
    hrthfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavk
    nfsdvhpeygsriqalldkyneekpknavhtyvqhgshlsarekanl
    

    Sequence, based on observed residues (ATOM records):
    >5gknD (D:)
    nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
    fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
    dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
    dfwslrpeslhqvsflfsdrgipdghrhmngygshtfklvnangeavyckfhyktdqgik
    nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
    phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
    hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
    hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
    dvhpeygsriqalldkyne