PDB entry 5gkj

View 5gkj on RCSB PDB site
Description: structure of endoms in apo form
Deposited on 2016-07-04, released 2016-11-02
The last revision was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endonuclease EndoMS
    Species: Thermococcus kodakarensis KOD1 [TaxId:69014]
    Gene: TK1898
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5JER9
      • engineered mutation (164)
  • Chain 'B':
    Compound: Endonuclease EndoMS
    Species: Thermococcus kodakarensis KOD1 [TaxId:69014]
    Gene: TK1898
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5JER9
      • engineered mutation (164)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gkjA (A:)
    mskdkvtvitspsteelvslvnsalleeamltifarckvhydgrakselgsgdrviivkp
    dgsflihqskkrepvnwqppgsrvrlelrenpvlvsirrkpretleveleevymvsvfra
    edyeelaltgseaemaelifenpeviepgfkplfrekaigtgivavlgrdsdgnivvlel
    krrraelhavrqlksyveilreeygdkvrgilvapsltsgakrllekeglefrkleppkr
    dskkkgrqktlf
    

    Sequence, based on observed residues (ATOM records):
    >5gkjA (A:)
    kvtvitspsteelvslvnsalleeamltifarckvhydgrakselgsgdrviivkpdgsf
    lihqskkrepvnwqppgsrvrlelrenpvlvsirrkpretleveleevymvsvfraedye
    maelifenpeviepgfkplfavlgrdsdgnivvlelkrrraelhavrqlksyveilreey
    gdkvrgilvapsltsgakrllekeglefrklep
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gkjB (B:)
    mskdkvtvitspsteelvslvnsalleeamltifarckvhydgrakselgsgdrviivkp
    dgsflihqskkrepvnwqppgsrvrlelrenpvlvsirrkpretleveleevymvsvfra
    edyeelaltgseaemaelifenpeviepgfkplfrekaigtgivavlgrdsdgnivvlel
    krrraelhavrqlksyveilreeygdkvrgilvapsltsgakrllekeglefrkleppkr
    dskkkgrqktlf
    

    Sequence, based on observed residues (ATOM records):
    >5gkjB (B:)
    dkvtvitspsteelvslvnsalleeamltifarckvhydgrakselgsgdrviivkpdgs
    flihqskkrepvnwqppgsrvrlelrenpvlvsirrkpretleveleevymvsvfraedy
    seaemaelifenpeviepgfkplfrekaigtgivavlgrdsdgnivvlelkrrraelhav
    rqlksyveilreeygdkvrgilvapsltsgakrllekeglefrkleppk