PDB entry 5gk7

View 5gk7 on RCSB PDB site
Description: Structure of E.Coli fructose 1,6-bisphosphate aldolase bound to Tris
Class: lyase
Keywords: FBA Tris bound, LYASE Aldolase EC 4.1.2.13 Fructose 1, 6-bisphosphate Glycolysis Anabolic pathways Catabolic pathways, LYASE
Deposited on 2016-07-03, released 2017-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-bisphosphate aldolase class 2
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fbaA, fba, fda, b2925, JW2892
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gk7a_
  • Chain 'B':
    Compound: Fructose-bisphosphate aldolase class 2
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fbaA, fba, fda, b2925, JW2892
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gk7b_
  • Heterogens: GOL, TRS, PEG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gk7A (A:)
    mskifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivq
    fsnggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwi
    dglldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctg
    geedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltpt
    ilrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegv
    lnyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gk7A (A:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctly
    tqpedvdyaytelskisprftiaasfgnvvltptilrdsqeyvskkhnlphnslnfvfhg
    gsgstaqeikdsvsygvvkmnidtdtqwatwegvlnyykaneaylqgqlgnpkgedqpnk
    kyydprvwlragqtsmiarlekafqelnaidvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gk7B (B:)
    mskifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivq
    fsnggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwi
    dglldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctg
    geedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltpt
    ilrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegv
    lnyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gk7B (B:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgclyt
    qpedvdyaytelskisprftiaasfgnvltptilrdsqeyvskkhnlphnslnfvfhggs
    gstaqeikdsvsygvvkmnidtdtqwatwegvlnyykaneaylqgqlgnpkgedqpnkky
    ydprvwlragqtsmiarlekafqelnaidvl