PDB entry 5gk5

View 5gk5 on RCSB PDB site
Description: Apo structure of fructose 1,6-bisphosphate aldolase from Escherichia coli at 1.9 angstrom resolution
Class: lyase
Keywords: FBA apo3, LYASE
Deposited on 2016-07-03, released 2017-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-bisphosphate aldolase class 2
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fbaA, fba, fda, b2925, JW2892
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gk5a_
  • Chain 'B':
    Compound: Fructose-bisphosphate aldolase class 2
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fbaA, fba, fda, b2925, JW2892
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gk5b_
  • Chain 'C':
    Compound: Fructose-bisphosphate aldolase class 2
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fbaA, fba, fda, b2925, JW2892
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gk5c_
  • Chain 'D':
    Compound: Fructose-bisphosphate aldolase class 2
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fbaA, fba, fda, b2925, JW2892
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gk5d_
  • Chain 'E':
    Compound: Fructose-bisphosphate aldolase class 2
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fbaA, fba, fda, b2925, JW2892
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gk5e_
  • Chain 'F':
    Compound: Fructose-bisphosphate aldolase class 2
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fbaA, fba, fda, b2925, JW2892
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gk5f_
  • Chain 'G':
    Compound: Fructose-bisphosphate aldolase class 2
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fbaA, fba, fda, b2925, JW2892
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gk5g_
  • Chain 'H':
    Compound: Fructose-bisphosphate aldolase class 2
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fbaA, fba, fda, b2925, JW2892
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gk5h_
  • Heterogens: GOL, ZN, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gk5A (A:)
    mskifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivq
    fsnggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwi
    dglldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctg
    geedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltpt
    ilrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegv
    lnyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gk5A (A:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgytqp
    edvdyaytelskisprftiaasfgnvhvvltptilrdsqeyvskkhnlphnslnfvfhgg
    sgstaqeikdsvsygvvkmnidtdtqwatwegvlnyykaneaylqgqlgnpkgedqpnkk
    yydprvwlragqtsmiarlekafqelnaidvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gk5B (B:)
    mskifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivq
    fsnggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwi
    dglldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctg
    geedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltpt
    ilrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegv
    lnyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gk5B (B:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgytqp
    edvdyaytelskisprftiaasfgnvhvltptilrdsqeyvskkhnlphnslnfvfhggs
    gstaqeikdsvsygvvkmnidtdtqwatwegvlnyykaneaylqgqlgnpkgedqpnkky
    ydprvwlragqtsmiarlekafqelnaidvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5gk5C (C:)
    mskifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivq
    fsnggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwi
    dglldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctg
    geedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltpt
    ilrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegv
    lnyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gk5C (C:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctly
    tqpedvdyaytelskisprftiaasfgnvhvvltptilrdsqeyvskkhnlphnslnfvf
    hggsgstaqeikdsvsygvvkmnidtdtqwatwegvlnyykaneaylqgqlgnpkgedqp
    nkkyydprvwlragqtsmiarlekafqelnaidvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5gk5D (D:)
    mskifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivq
    fsnggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwi
    dglldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctg
    geedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltpt
    ilrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegv
    lnyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gk5D (D:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgytqp
    edvdyaytelskisprftiaasfgnvhvltptilrdsqeyvskkhnlphnslnfvfhggs
    gstaqeikdsvsygvvkmnidtdtqwatwegvlnyykaneaylqgqlgnpkgedqpnkky
    ydprvwlragqtsmiarlekafqelnaidvl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5gk5E (E:)
    mskifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivq
    fsnggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwi
    dglldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctg
    geedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltpt
    ilrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegv
    lnyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gk5E (E:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctly
    tqpedvdyaytelskisprftiaasfgnvhvltptilrdsqeyvskkhnlphnslnfvfh
    ggsgstaqeikdsvsygvvkmnidtdtqwatwegvlnyykaneaylqgqlgnpkgedqpn
    kkyydprvwlragqtsmiarlekafqelnaidvl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5gk5F (F:)
    mskifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivq
    fsnggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwi
    dglldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctg
    geedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltpt
    ilrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegv
    lnyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gk5F (F:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgcytq
    pedvdyaytelskisprftiaasfgnvhvltptilrdsqeyvskkhnlphnslnfvfhgg
    sgstaqeikdsvsygvvkmnidtdtqwatwegvlnyykaneaylqgqlgnpkgedqpnkk
    yydprvwlragqtsmiarlekafqelnaidvl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5gk5G (G:)
    mskifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivq
    fsnggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwi
    dglldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctg
    geedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltpt
    ilrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegv
    lnyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gk5G (G:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctly
    tqpedvdyaytelskisprftiaasfgnvhvvltptilrdsqeyvskkhnlphnslnfvf
    hggsgstaqeikdsvsygvvkmnidtdtqwatwegvlnyykaneaylqgqlgnpkgedqp
    nkkyydprvwlragqtsmiarlekafqelnaidvl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5gk5H (H:)
    mskifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivq
    fsnggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwi
    dglldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctg
    geedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltpt
    ilrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegv
    lnyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gk5H (H:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgytqp
    edvdyaytelskisprftiaasfgnvhvltptilrdsqeyvskkhnlphnslnfvfhggs
    gstaqeikdsvsygvvkmnidtdtqwatwegvlnyykaneaylqgqlgnpkgedqpnkky
    ydprvwlragqtsmiarlekafqelnaidvl