PDB entry 5gjy

View 5gjy on RCSB PDB site
Description: crystal structure of duck mhc class i for 1.71 angstrom
Deposited on 2016-07-02, released 2017-05-10
The last revision was dated 2017-05-10, with a file datestamp of 2017-05-05.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class I antigen
    Species: Anas platyrhynchos [TaxId:8839]
    Gene: Du5MHC I
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6I7L2 (3-272)
      • engineered mutation (219)
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Anas platyrhynchos [TaxId:8839]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: met-val-met-glu-leu-ile-arg-met-ile
    Species: UNIDENTIFIED INFLUENZA VIRUS, synthetic [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GJY (0-8)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gjyA (A:)
    mefephslryfytavsdpspgvpqfvtvgsvdgevfvrydsetrkmeprvdwivanvdqq
    ywdretetsrgneqifrvnldtarerynqsrgshtwqcmhgcdledgsirgfqqcgydgk
    dfialdkdtltytaadaaaqitkrkweqegtvaeqwknylentciewlrkyvsygkdvle
    rrerpkvrvsgmesnkiltlscrahgfypppisiswlkdgvvqeqetkrgstvpnsdgty
    hawatidvlpgnrdkyqcrvehaslpqpglfsw
    

    Sequence, based on observed residues (ATOM records):
    >5gjyA (A:)
    ephslryfytavsdpspgvpqfvtvgsvdgevfvrydsetrkmeprvdwivanvdqqywd
    retetsrgneqifrvnldtarerynqsrgshtwqcmhgcdledgsirgfqqcgydgkdfi
    aldkdtltytaadaaaqitkrkweqegtvaeqwknylentciewlrkyvsygkdvlerre
    rpkvrvsgmeltlscrahgfypppisiswlkdgvvqeqetkrgstvpnsdgtyhawatid
    vlpgnrdkyqcrvehaslpqpglfsw
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gjyB (B:)
    mefgqakaapkvqvysrhpatagtenilncyvegfhppkidiallkngepmkdvkyndms
    fgddwtfqrlvyapftptksdvytcrvdheaftepqsfrwepdf
    

    Sequence, based on observed residues (ATOM records):
    >5gjyB (B:)
    qakaapkvqvysrhpatagtenilncyvegfhppkidiallkngepmkdvkyndmsfgdd
    wtfqrlvyapftptksdvytcrvdheaftepqsfrwepdf
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5gjyC (C:)
    mvmelirmi
    

    Sequence, based on observed residues (ATOM records):
    >5gjyC (C:)
    mvlirmi