PDB entry 5gj6

View 5gj6 on RCSB PDB site
Description: Functional and structural characterization of P[19] rotavirus VP8* interaction with histo-blood group antigens
Class: viral protein
Keywords: Rotavirus, P[19] VP8*, VIRAL PROTEIN
Deposited on 2016-06-28, released 2016-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer capsid protein VP4
    Species: Human rotavirus A [TaxId:10941]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gj6a_
  • Chain 'B':
    Compound: Outer capsid protein VP4
    Species: Human rotavirus A [TaxId:10941]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gj6b_
  • Chain 'C':
    Compound: Outer capsid protein VP4
    Species: Human rotavirus A [TaxId:10941]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gj6c_
  • Chain 'D':
    Compound: Outer capsid protein VP4
    Species: Human rotavirus A [TaxId:10941]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gj6d_
  • Chain 'E':
    Compound: Outer capsid protein VP4
    Species: Human rotavirus A [TaxId:10941]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gj6e_
  • Chain 'F':
    Compound: Outer capsid protein VP4
    Species: Human rotavirus A [TaxId:10941]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gj6f_
  • Chain 'G':
    Compound: Outer capsid protein VP4
    Species: Human rotavirus A [TaxId:10941]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gj6g_
  • Chain 'H':
    Compound: Outer capsid protein VP4
    Species: Human rotavirus A [TaxId:10941]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gj6h_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gj6A (A:)
    vldgpyqpvafkppndywilvnsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg
    vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna
    ttdysttsnlneisvttyaefyiiprsqeskcteyintgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gj6B (B:)
    vldgpyqpvafkppndywilvnsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg
    vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna
    ttdysttsnlneisvttyaefyiiprsqeskcteyintgl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gj6C (C:)
    vldgpyqpvafkppndywilvnsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg
    vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna
    ttdysttsnlneisvttyaefyiiprsqeskcteyintgl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gj6D (D:)
    vldgpyqpvafkppndywilvnsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg
    vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna
    ttdysttsnlneisvttyaefyiiprsqeskcteyintgl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gj6E (E:)
    vldgpyqpvafkppndywilvnsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg
    vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna
    ttdysttsnlneisvttyaefyiiprsqeskcteyintgl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gj6F (F:)
    vldgpyqpvafkppndywilvnsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg
    vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna
    ttdysttsnlneisvttyaefyiiprsqeskcteyintgl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gj6G (G:)
    vldgpyqpvafkppndywilvnsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg
    vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna
    ttdysttsnlneisvttyaefyiiprsqeskcteyintgl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gj6H (H:)
    vldgpyqpvafkppndywilvnsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg
    vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna
    ttdysttsnlneisvttyaefyiiprsqeskcteyintgl