PDB entry 5ghv

View 5ghv on RCSB PDB site
Description: Crystal structure of an inhibitor-bound Syk
Class: transferase/transferase inhibitor
Keywords: SYK KINASE, INHIBITOR, SPLEEN TYROSINE KINASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2016-06-20, released 2016-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ghva_
  • Chain 'B':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ghvb_
  • Heterogens: X5G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ghvA (A:)
    eeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkd
    ellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielv
    hqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwp
    vkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpa
    gcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvnlehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ghvA (A:)
    vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilknpalkdellaeanvmqq
    ldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyle
    esnfvhrdlaarnvllvtqhyakisdfglskalradenyykakwpvkwyapecinyykfs
    sksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwt
    ydvenrpgfaavelrlrnyyydvvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ghvB (B:)
    eeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkd
    ellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielv
    hqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwp
    vkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpa
    gcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvnlehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ghvB (B:)
    vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilknpalkdellaeanvmqq
    ldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyle
    esnfvhrdlaarnvllvtqhyakisdfglskalradenyykakwpvkwyapecinyykfs
    sksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwt
    ydvenrpgfaavelrlrnyyydvvn