PDB entry 5ghb

View 5ghb on RCSB PDB site
Description: solution structure of lys42 acetylated human sumo2
Class: structural genomics
Keywords: ubiquitin-like protein, acetylated protein, structural genomics
Deposited on 2016-06-19, released 2017-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small ubiquitin-related modifier 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SUMO2, SMT3B, SMT3H2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5ghba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5ghbA (A:)
mgsshhhhhhsqdpmadekpkegvktenndhinlkvagqdgsvvqfkikrhtplsklmka
ycerqglsmrqirfrfdgqpinetdtpaqlemededtidvfqqqtgg

    Sequence, based on observed residues (ATOM records): (download) 
    >5ghbA (A:)
madekpkegvktenndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirf
rfdgqpinetdtpaqlemededtidvfqqqtgg