PDB entry 5gcn

View 5gcn on RCSB PDB site
Description: catalytic domain of tetrahymena gcn5 histone acetyltransferase in complex with coenzyme a
Deposited on 1999-03-24, released 1999-07-19
The last revision prior to the SCOP 1.59 freeze date was dated 1999-07-19, with a file datestamp of 1999-07-18.
Experiment type: NMR24
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d5gcna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gcnA (A:)
    mkglldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkq
    kviggicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnf
    aigyfkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdygn