PDB entry 5gat

View 5gat on RCSB PDB site
Description: solution nmr structure of the wild type dna binding domain of area complexed to a 13bp dna containing a cgata site, 35 structures
Deposited on 1997-11-07, released 1998-01-28
The last revision prior to the SCOP 1.55 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: NMR35
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d5gata_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5gatA (A:)
  mkngeqngpttctncftqttplwrrnpegqplcnacglflklhgvvrplslktdvikkrn
  rnsans