PDB entry 5g5x

View 5g5x on RCSB PDB site
Description: CBS domain tandem of site-2 protease from Archaeoglobus fulgidus in complex with llama Nanobody - nucleotide-bound form
Class: hydrolase
Keywords: hydrolase, metalloprotease, site-2 protease, regulatory domain, nucleotide-binding, cbs domain, camelid antibody, nanobody
Deposited on 2016-06-09, released 2017-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-19, with a file datestamp of 2017-07-14.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: site-2 protease
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29915 (1-End)
      • expression tag (0)
  • Chain 'B':
    Compound: Nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5G5X (0-End)
    Domains in SCOPe 2.07: d5g5xb1, d5g5xb2
  • Heterogens: AMP, ATP

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5g5xB (B:)
    qvqlqesggglvqpggslrlscaasgsgfnnnamgwyrqapgkqrelvaaitsfgstnya
    dsvkgrftisrdnakntvylqmnslkpedtavyyctagwgatprsywgqgtqvtvsshhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g5xB (B:)
    qvqlqesggglvqpggslrlscaasgsgfnnnamgwyrqapgkqrelvaaitsfgstnya
    dsvkgrftisrdnakntvylqmnslkpedtavyyctagwgatprsywgqgtqvtvssh