PDB entry 5g5h

View 5g5h on RCSB PDB site
Description: Escherichia coli Periplasmic Aldehyde Oxidase R440H mutant
Class: oxidoreductase
Keywords: oxidoreductase, paoabc, xanthine oxidase family, heterotrimer, e.coli detoxification
Deposited on 2016-05-25, released 2016-09-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative xanthine dehydrogenase yagt iron-sulfur-binding subunit
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5g5ha1, d5g5ha2
  • Chain 'B':
    Compound: putative xanthine dehydrogenase yags fad-binding subunit
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: putative xanthine dehydrogenase yagr molybdenum-binding subunit
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77489 (0-End)
      • cloning artifact (87)
      • cloning artifact (390)
      • engineered mutation (439)
  • Heterogens: FES, IOD, ACT, CL, SF4, FAD, CSD, MCN, MOS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5g5hA (A:)
msnqgeypednrvgkhephdlsltrrdlikvsaataatavvyphstlaasvpaatpapei
mpltlkvngkteqlevdtrttlldtlrenlhligtkkgcdhgqcgactvlvngrrlnacl
tlavmhqgaeittieglgspdnlhpmqaafikhdgfqcgyctsgqicssvavlkeiqdgi
pshvtvdlvsapettadeirermsgnicrcgayanilaaiedaageiks

    Sequence, based on observed residues (ATOM records): (download) 
    >5g5hA (A:)
aatpapeimpltlkvngkteqlevdtrttlldtlrenlhligtkkgcdhgqcgactvlvn
grrlnacltlavmhqgaeittieglgspdnlhpmqaafikhdgfqcgyctsgqicssvav
lkeiqdgipshvtvdlvsapettadeirermsgnicrcgayanilaaiedaag

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.