PDB entry 5g5d

View 5g5d on RCSB PDB site
Description: Crystal Structure of the CohScaC2-XDocCipA type II complex from Clostridium thermocellum
Class: carbohydrate binding protein
Keywords: carbohydrate binding protein, cohesin-dockerin complex, type II interaction, scaffoldin, cellulosome, c. thermocellum
Deposited on 2016-05-23, released 2017-04-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellulosome anchoring protein cohesin region
    Species: RUMINICLOSTRIDIUM THERMOCELLUM AD2 [TaxId:1138384]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5g5da_
  • Chain 'B':
    Compound: Cellulosomal-scaffolding protein A
    Species: Clostridium thermocellum [TaxId:203119]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06851
      • conflict (101)
    Domains in SCOPe 2.08: d5g5db1, d5g5db2
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5g5dA (A:)
    masahialeldktkvkvgdvivatvkaknmtsmagiqvnikydpevlqaidpatgkpftk
    etllvdpellsnreynplltavndinsgiinyascyvywdsyresgvsestgiigkvgfk
    vlkaanttvkleetrftpnsidgtlvidwygqqivgykviqpdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g5dA (A:)
    ahialeldktkvkvgdvivatvkaknmtsmagiqvnikydpevlqaidpatgkpftketl
    lvdpellsnreynplltavndinsgiinyascyvywdsyresgvsestgiigkvgfkvlk
    aanttvkleetrftpnsidgtlvidwygqqivgykviqpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5g5dB (B:)
    mnkpviegykvsgyilpdfsfdatvaplvkagfkveivgtelyavtdangyfeitgvpan
    asgytlkisratyldrvianvvvtgdtsvstsqapimmwvgkivkdnsinlldvaevirc
    fnatkgsanyveeldinrngainmqdimivhkhfgatssdydaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g5dB (B:)
    gykvsgyilpdfsfdatvaplvkagfkveivgtelyavtdangyfeitgvpanasgytlk
    isratyldrvianvvvtgdtsvstsqapimmwvgkivkdnsinlldvaevircfnatkgs
    anyveeldinrngainmqdimivhkhfgatssdyda