PDB entry 5g4l

View 5g4l on RCSB PDB site
Description: Phloroglucinol reductase from Clostridium sp. with bound NADPH
Class: oxidoreductase
Keywords: oxidoreductase, flavonoid degradation, enzyme catalysis, dearomatisation reaction, short-chain dehydrogenases/reductases, nadph dependent enzyme
Deposited on 2016-05-13, released 2016-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxidoreductase, short chain dehydrogenase/reductase family protein
    Species: CLOSTRIDIUM SP. [TaxId:1506]
    Database cross-references and differences (RAF-indexed):
    • Uniprot U2C7W9 (22-285)
      • expression tag (21)
    Domains in SCOPe 2.07: d5g4la1, d5g4la2
  • Chain 'B':
    Compound: Oxidoreductase, short chain dehydrogenase/reductase family protein
    Species: CLOSTRIDIUM SP. [TaxId:1506]
    Database cross-references and differences (RAF-indexed):
    • Uniprot U2C7W9 (22-285)
      • expression tag (21)
    Domains in SCOPe 2.07: d5g4lb1, d5g4lb2
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5g4lA (A:)
    mghhhhhhhhhhssghidddkhmvnvkkefvdnmfsvkgkvalvtgatgalgcvlskayg
    yagakvfmtgrnekklqaleaefkaegidcaygvadpadeaqvdamitacvaqygevnil
    avthgfnkpqnileqsvadwqyimdadcksvyvvckyvaqqmvdqgkggkivvvtsqrsk
    rgmagytgyctskggadlmvssmacdlsakyginvnsicptvfrsdltewmfdpesavyq
    nflkrepigrlaepedfvgyalflssdasnyitgancdcsggyltc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g4lA (A:)
    hmvnvkkefvdnmfsvkgkvalvtgatgalgcvlskaygyagakvfmtgrnekklqalea
    efkaegidcaygvadpadeaqvdamitacvaqygevnilavthgfnkpqnileqsvadwq
    yimdadcksvyvvckyvaqqmvdqgkggkivvvtsqrskrgmagytgyctskggadlmvs
    smacdlsakyginvnsicptvfrsdltewmfdpesavyqnflkrepigrlaepedfvgya
    lflssdasnyitgancdcsggyltc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5g4lB (B:)
    mghhhhhhhhhhssghidddkhmvnvkkefvdnmfsvkgkvalvtgatgalgcvlskayg
    yagakvfmtgrnekklqaleaefkaegidcaygvadpadeaqvdamitacvaqygevnil
    avthgfnkpqnileqsvadwqyimdadcksvyvvckyvaqqmvdqgkggkivvvtsqrsk
    rgmagytgyctskggadlmvssmacdlsakyginvnsicptvfrsdltewmfdpesavyq
    nflkrepigrlaepedfvgyalflssdasnyitgancdcsggyltc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g4lB (B:)
    hmvnvkkefvdnmfsvkgkvalvtgatgalgcvlskaygyagakvfmtgrnekklqalea
    efkaegidcaygvadpadeaqvdamitacvaqygevnilavthgfnkpqnileqsvadwq
    yimdadcksvyvvckyvaqqmvdqgkggkivvvtsqrskrgmagytgyctskggadlmvs
    smacdlsakyginvnsicptvfrsdltewmfdpesavyqnflkrepigrlaepedfvgya
    lflssdasnyitgancdcsggyltc