PDB entry 5g4c

View 5g4c on RCSB PDB site
Description: Human SIRT2 catalyse short chain fatty acyl lysine
Class: hydrolase
Keywords: hydrolase, sirtuin class I, hdacs, nad dependent, adpr, acyl
Deposited on 2016-05-09, released 2017-05-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nad-dependent protein deacetylase sirtuin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT2, SIR2L, SIR2L2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g4ca_
  • Chain 'B':
    Compound: nad-dependent protein deacetylase sirtuin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT2, SIR2L, SIR2L2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g4cb_
  • Chain 'E':
    Compound: sirt2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5G4C (0-4)
  • Chain 'F':
    Compound: sirt2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5G4C (0-4)
  • Heterogens: ZN, CNA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5g4cA (A:)
    geadmdflrnlfsqtlslgsqkerlldeltlegvarymqsercrrviclvgagistsagi
    pdfrspstglydnlekyhlpypeaifeisyfkkhpepffalakelypgqfkptichyfmr
    llkdkglllrcytqnidtleriagleqedlveahgtfytshcvsascrheyplswmkeki
    fsevtpkcedcqslvkpdivffgeslparffscmqsdflkvdlllvmgtslqvqpfasli
    skaplstprllinkekagqsdpflgmimglgggmdfdskkayrdvawlgecdqgclalae
    llgwkkeledlvrrehasidaqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g4cA (A:)
    qkerlldeltlegvarymqsercrrviclvgagistsagipdfrsptglydnlekyhlpy
    peaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtler
    iagleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivf
    fgeslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqgg
    mdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5g4cB (B:)
    geadmdflrnlfsqtlslgsqkerlldeltlegvarymqsercrrviclvgagistsagi
    pdfrspstglydnlekyhlpypeaifeisyfkkhpepffalakelypgqfkptichyfmr
    llkdkglllrcytqnidtleriagleqedlveahgtfytshcvsascrheyplswmkeki
    fsevtpkcedcqslvkpdivffgeslparffscmqsdflkvdlllvmgtslqvqpfasli
    skaplstprllinkekagqsdpflgmimglgggmdfdskkayrdvawlgecdqgclalae
    llgwkkeledlvrrehasidaqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g4cB (B:)
    qkerlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhlp
    ypeaifeisyfkkhpepffalakelpgqfkptichyfmrllkdkglllrcytqnidtler
    iagleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivf
    fgeslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqsg
    gmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaq
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.