PDB entry 5g3m

View 5g3m on RCSB PDB site
Description: Discovery of a novel secreted phospholipase A2 (sPLA2) inhibitor.
Class: hydrolase
Keywords: hydrolase, spla2, cardiovascular disease, inhibitor, fragment
Deposited on 2016-04-29, released 2016-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: group 10 secretory phospholipase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5g3ma_
  • Chain 'B':
    Compound: group 10 secretory phospholipase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5g3mb_
  • Heterogens: CA, DMS, PEG, 9JH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5g3mA (A:)
    gilelagtvgcvgprtpiaymkygcfcglgghgqprdaidwcchghdccytraeeagcsp
    kteryswqcvnqsvlcgpaenkcqellckcdqeianclaqteynlkylfypqflcepdsp
    kcd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5g3mB (B:)
    gilelagtvgcvgprtpiaymkygcfcglgghgqprdaidwcchghdccytraeeagcsp
    kteryswqcvnqsvlcgpaenkcqellckcdqeianclaqteynlkylfypqflcepdsp
    kcd