PDB entry 5g30

View 5g30 on RCSB PDB site
Description: Crystallographic structure of mutant D60S of thioredoxin from Litopenaeus vannamei
Class: oxidoreductase
Keywords: oxidoreductase, thioredoxin, shrimp, litopenaeus vannamei, mutant, disulfide bond
Deposited on 2016-04-18, released 2017-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: LITOPENAEUS VANNAMEI [TaxId:6689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PWB9 (0-104)
      • conflict (10)
      • engineered mutation (59)
    Domains in SCOPe 2.07: d5g30a_
  • Chain 'B':
    Compound: thioredoxin
    Species: LITOPENAEUS VANNAMEI [TaxId:6689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PWB9 (0-104)
      • conflict (10)
      • engineered mutation (59)
    Domains in SCOPe 2.07: d5g30b_
  • Chain 'C':
    Compound: thioredoxin
    Species: LITOPENAEUS VANNAMEI [TaxId:6689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PWB9 (0-104)
      • conflict (10)
      • engineered mutation (59)
    Domains in SCOPe 2.07: d5g30c_
  • Chain 'D':
    Compound: thioredoxin
    Species: LITOPENAEUS VANNAMEI [TaxId:6689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1PWB9 (0-104)
      • conflict (10)
      • engineered mutation (59)
    Domains in SCOPe 2.07: d5g30d_
  • Heterogens: ACT, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5g30A (A:)
    mvyqvkdqedftkqlneagnklvvidfyatwcgpckmiapkleelsqsmsdvvflkvdvs
    ecediaqdnqiacmptflfmkngqkldslsganydkllelveknk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5g30B (B:)
    mvyqvkdqedftkqlneagnklvvidfyatwcgpckmiapkleelsqsmsdvvflkvdvs
    ecediaqdnqiacmptflfmkngqkldslsganydkllelveknk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5g30C (C:)
    mvyqvkdqedftkqlneagnklvvidfyatwcgpckmiapkleelsqsmsdvvflkvdvs
    ecediaqdnqiacmptflfmkngqkldslsganydkllelveknk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5g30D (D:)
    mvyqvkdqedftkqlneagnklvvidfyatwcgpckmiapkleelsqsmsdvvflkvdvs
    ecediaqdnqiacmptflfmkngqkldslsganydkllelveknk