PDB entry 5g2p

View 5g2p on RCSB PDB site
Description: The crystal structure of a S-selective transaminase from Arthrobacter sp.
Class: transferase
Keywords: transferase, transaminase
Deposited on 2016-04-12, released 2016-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-24, with a file datestamp of 2016-08-18.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transaminase
    Species: Arthrobacter sp. [TaxId:1667]
    Database cross-references and differences (RAF-indexed):
    • PDB 5G2P
    Domains in SCOPe 2.07: d5g2pa_
  • Chain 'B':
    Compound: Transaminase
    Species: Arthrobacter sp. [TaxId:1667]
    Database cross-references and differences (RAF-indexed):
    • PDB 5G2P
    Domains in SCOPe 2.07: d5g2pb_
  • Chain 'C':
    Compound: Transaminase
    Species: Arthrobacter sp. [TaxId:1667]
    Database cross-references and differences (RAF-indexed):
    • PDB 5G2P
    Domains in SCOPe 2.07: d5g2pc_
  • Chain 'D':
    Compound: Transaminase
    Species: Arthrobacter sp. [TaxId:1667]
    Database cross-references and differences (RAF-indexed):
    • PDB 5G2P
    Domains in SCOPe 2.07: d5g2pd_
  • Heterogens: CL, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5g2pA (A:)
    mgltvqkinweqvkewdrkylmrtfstqneyqpvpiestegdylitpggtrlldffnqlc
    cvnlgqknqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvst
    gseavetalniarlytnrplvvtrehdyhgwtggaatvtrlrsfrsglvgensesfsaqi
    pgsscssavlmapssntfqdsngnylkdengellsvkytrrmienygpeqvaavitevsq
    gvgstmppyeyvpqirkmtkelgvlwisdevltgfgrtgkwfgyqhygvqpdiitmgkgl
    sssslpagavvvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenlveqakns
    geyirsklellqekhksignfdgygllwivdivnaktktpyvkldrnfrhgmnpnqiptq
    iimekalekgvliggampntmrigaslnvsrgdidkamdaldyaldylesgewqqsaleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g2pA (A:)
    kinweqvkewdrkylmrtfstqneyqpvpiestegdylitpggtrlldffnqlccvnlgq
    knqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvstgseave
    talniarlytnrplvvtrehdyhgwtggaatvtrlrsfrsglvgensesfsaqipgssav
    lmapssntfqnylkdengellsvkytrrmienygpeqvaavitevsqgvgstmppyeyvp
    qirkmtkelgvlwisdevltgfgrtgkwfgyqhygvqpdiitmgkglsssslpagavvvs
    keiaafmdkhrwesvstyaghpvamaavcanlevmmeenlveqaknsgeyirsklellqe
    khksignfdgygllwivdivnaktktpyvkldrnfrhgmnpnqiptqiimekalekgvli
    ggampntmrigaslnvsrgdidkamdaldyaldylesgewq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5g2pB (B:)
    mgltvqkinweqvkewdrkylmrtfstqneyqpvpiestegdylitpggtrlldffnqlc
    cvnlgqknqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvst
    gseavetalniarlytnrplvvtrehdyhgwtggaatvtrlrsfrsglvgensesfsaqi
    pgsscssavlmapssntfqdsngnylkdengellsvkytrrmienygpeqvaavitevsq
    gvgstmppyeyvpqirkmtkelgvlwisdevltgfgrtgkwfgyqhygvqpdiitmgkgl
    sssslpagavvvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenlveqakns
    geyirsklellqekhksignfdgygllwivdivnaktktpyvkldrnfrhgmnpnqiptq
    iimekalekgvliggampntmrigaslnvsrgdidkamdaldyaldylesgewqqsaleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g2pB (B:)
    kinweqvkewdrkylmrtfstqneyqpvpiestegdylitpggtrlldffnqlccvnlgq
    knqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvstgseave
    talniarlytnrplvvtrehdyhgwtggaatvtrlrsfrsglvgensesfsaqipgssav
    lmapssntfqdsngnylkdengellsvkytrrmienygpeqvaavitevsqgvgstmppy
    eyvpqirkmtkelgvlwisdevltgfgrtgkwfgyqhygvqpdiitmgkglsssslpaga
    vvvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenlveqaknsgeyirskle
    llqekhksignfdgygllwivdivnaktktpyvkldrnfrhgmnpnqiptqiimekalek
    gvliggampntmrigaslnvsrgdidkamdaldyaldylesgew
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5g2pC (C:)
    mgltvqkinweqvkewdrkylmrtfstqneyqpvpiestegdylitpggtrlldffnqlc
    cvnlgqknqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvst
    gseavetalniarlytnrplvvtrehdyhgwtggaatvtrlrsfrsglvgensesfsaqi
    pgsscssavlmapssntfqdsngnylkdengellsvkytrrmienygpeqvaavitevsq
    gvgstmppyeyvpqirkmtkelgvlwisdevltgfgrtgkwfgyqhygvqpdiitmgkgl
    sssslpagavvvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenlveqakns
    geyirsklellqekhksignfdgygllwivdivnaktktpyvkldrnfrhgmnpnqiptq
    iimekalekgvliggampntmrigaslnvsrgdidkamdaldyaldylesgewqqsaleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g2pC (C:)
    kinweqvkewdrkylmrtfstqneyqpvpiestegdylitpggtrlldffnqlccvnlgq
    knqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvstgseave
    talniarlytnrplvvtrehdyhgwtggaatvtrlrsfrsglvgensesfsaqipgssav
    lmapssntfqgnylkdengellsvkytrrmienygpeqvaavitevsqgvgstmppyeyv
    pqirkmtkelgvlwisdevltgfgrtgkwfgyqhygvqpdiitmgkglsssslpagavvv
    skeiaafmdkhrwesvstyaghpvamaavcanlevmmeenlveqaknsgeyirsklellq
    ekhksignfdgygllwivdivnaktktpyvkldrnfrhgmnpnqiptqiimekalekgvl
    iggampntmrigaslnvsrgdidkamdaldyaldylesgew
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5g2pD (D:)
    mgltvqkinweqvkewdrkylmrtfstqneyqpvpiestegdylitpggtrlldffnqlc
    cvnlgqknqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvst
    gseavetalniarlytnrplvvtrehdyhgwtggaatvtrlrsfrsglvgensesfsaqi
    pgsscssavlmapssntfqdsngnylkdengellsvkytrrmienygpeqvaavitevsq
    gvgstmppyeyvpqirkmtkelgvlwisdevltgfgrtgkwfgyqhygvqpdiitmgkgl
    sssslpagavvvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenlveqakns
    geyirsklellqekhksignfdgygllwivdivnaktktpyvkldrnfrhgmnpnqiptq
    iimekalekgvliggampntmrigaslnvsrgdidkamdaldyaldylesgewqqsaleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g2pD (D:)
    kinweqvkewdrkylmrtfstqneyqpvpiestegdylitpggtrlldffnqlccvnlgq
    knqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvstgseave
    talniarlytnrplvvtrehdyhgwtggaatvtrlrsfrsglvgensesfsaqipgssav
    lmapssntfqdgnylkdengellsvkytrrmienygpeqvaavitevsqgvgstmppyey
    vpqirkmtkelgvlwisdevltgfgrtgkwfgyqhygvqpdiitmgkglsssslpagavv
    vskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenlveqaknsgeyirsklell
    qekhksignfdgygllwivdivnaktktpyvkldrnfrhgmnpnqiptqiimekalekgv
    liggampntmrigaslnvsrgdidkamdaldyaldylesgew