PDB entry 5g2g

View 5g2g on RCSB PDB site
Description: Crystal structure of ketosteroid isomerase containing M116K mutation in the equilenin-bound form
Class: isomerase
Keywords: isomerase, ketosteroid isomerase, catalysis, stability, structural analysis, conserved met112
Deposited on 2016-04-08, released 2016-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445 (0-126)
      • engineered mutation (114)
    Domains in SCOPe 2.07: d5g2ga_
  • Chain 'B':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445 (Start-126)
      • engineered mutation (114)
    Domains in SCOPe 2.07: d5g2gb_
  • Heterogens: EQU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5g2gA (A:)
    nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
    gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtkqayws
    evnlsvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5g2gB (B:)
    nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
    gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtkqayws
    evnlsvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g2gB (B:)
    lptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqglg
    ggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtkqaywse
    vnlsvr