PDB entry 5g1s

View 5g1s on RCSB PDB site
Description: Open conformation of Francisella tularensis ClpP at 1.7 A
Class: hydrolase
Keywords: hydrolase
Deposited on 2016-03-30, released 2016-10-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g1sa_
  • Chain 'B':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g1sb_
  • Chain 'C':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g1sc_
  • Chain 'D':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g1sd_
  • Chain 'E':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g1se_
  • Chain 'F':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g1sf_
  • Chain 'G':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g1sg_
  • Chain 'H':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g1sh_
  • Chain 'I':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g1si_
  • Chain 'J':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g1sj_
  • Chain 'K':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g1sk_
  • Chain 'L':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g1sl_
  • Chain 'M':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g1sm_
  • Chain 'N':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g1sn_
  • Chain 'O':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g1so_
  • Chain 'P':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g1sp_
  • Chain 'Q':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g1sq_
  • Chain 'R':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g1sr_
  • Chain 'S':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g1ss_
  • Chain 'T':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g1st_
  • Chain 'U':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5g1su_
  • Heterogens: MRD, ACT, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5g1sA (A:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1sA (A:)
    lvptviekrafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinsp
    ggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplg
    gfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglid
    hviesrea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5g1sB (B:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1sB (B:)
    nlvptvafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspggm
    vtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplggfr
    gqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhvi
    esr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5g1sC (C:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1sC (C:)
    nlvptviafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspgg
    mvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplggf
    rgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhv
    iesreaiik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5g1sD (D:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1sD (D:)
    lvptviekafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspg
    gmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplgg
    frgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidh
    viesrea
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5g1sE (E:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1sE (E:)
    nlvptviafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspgg
    mvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplggf
    rgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhv
    iesreaiik
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5g1sF (F:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1sF (F:)
    nlvptviektgerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfy
    inspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimih
    qplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakay
    glidhviesre
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5g1sG (G:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1sG (G:)
    lvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyf
    yinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimi
    hqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeaka
    yglidhviesrea
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5g1sH (H:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1sH (H:)
    lvptviekgerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyin
    spggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqp
    lggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakaygl
    idhviesrea
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5g1sI (I:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1sI (I:)
    lvptvrafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspggm
    vtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplggfr
    gqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhvi
    esre
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5g1sJ (J:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1sJ (J:)
    nlvptvifdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspggm
    vtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplggfr
    gqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhvi
    esreaiik
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5g1sK (K:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1sK (K:)
    lvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyf
    yinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimi
    hqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeaka
    yglidhviesrea
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5g1sL (L:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1sL (L:)
    nlvptvafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspggm
    vtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplggfr
    gqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhvi
    esreaiik
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5g1sM (M:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1sM (M:)
    nlvptviektagerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyf
    yinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimi
    hqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeaka
    yglidhviesre
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5g1sN (N:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1sN (N:)
    lvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyf
    yinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimi
    hqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeaka
    yglidhviesrea
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5g1sO (O:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1sO (O:)
    nlvptvieerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyins
    pggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqpl
    ggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakaygli
    dhviesrea
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5g1sP (P:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1sP (P:)
    lvptvfdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspggmvt
    agmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplggfrgq
    asdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhvies
    r
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >5g1sQ (Q:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1sQ (Q:)
    nlvptviafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspgg
    mvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplggf
    rgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhv
    iesreaii
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >5g1sR (R:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1sR (R:)
    lvptviekfdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspgg
    mvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplggf
    rgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhv
    iesrea
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >5g1sS (S:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1sS (S:)
    lvptvierafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspg
    gmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplgg
    frgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidh
    viesreaiik
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >5g1sT (T:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1sT (T:)
    nlvptviektgerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfy
    inspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimih
    qplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakay
    glidhviesre
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >5g1sU (U:)
    mitnnlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpd
    kdiyfyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslps
    sqimihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmma
    deakayglidhviesreaiik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g1sU (U:)
    lvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyf
    yinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimi
    hqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeaka
    yglidhviesrea