PDB entry 5g0a

View 5g0a on RCSB PDB site
Description: The crystal structure of a S-selective transaminase from Bacillus megaterium
Class: transferase
Keywords: transferase, transaminase
Deposited on 2016-03-17, released 2016-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-24, with a file datestamp of 2016-08-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transaminase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0Q9UXH6 (Start-473)
      • conflict (68)
      • conflict (89)
      • conflict (201)
      • conflict (204)
      • conflict (267)
      • conflict (317)
      • conflict (321)
      • conflict (358)
      • conflict (451)
    Domains in SCOPe 2.07: d5g0aa_
  • Chain 'B':
    Compound: Transaminase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0Q9UXH6 (Start-473)
      • conflict (68)
      • conflict (89)
      • conflict (201)
      • conflict (204)
      • conflict (267)
      • conflict (317)
      • conflict (321)
      • conflict (358)
      • conflict (451)
    Domains in SCOPe 2.07: d5g0ab_
  • Chain 'C':
    Compound: Transaminase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0Q9UXH6 (Start-473)
      • conflict (68)
      • conflict (89)
      • conflict (201)
      • conflict (204)
      • conflict (267)
      • conflict (317)
      • conflict (321)
      • conflict (358)
      • conflict (451)
    Domains in SCOPe 2.07: d5g0ac_
  • Chain 'D':
    Compound: Transaminase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0Q9UXH6 (Start-473)
      • conflict (68)
      • conflict (89)
      • conflict (201)
      • conflict (204)
      • conflict (267)
      • conflict (317)
      • conflict (321)
      • conflict (358)
      • conflict (451)
    Domains in SCOPe 2.07: d5g0ad_
  • Heterogens: PLP, 1PE, PEG, PGE, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5g0aA (A:)
    msltvqkinweqvkewdrkylmrtfstqneyqpvpiestegdylimpdgtrlldffnqly
    cvnlgqknqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvst
    gseavetalniarlytnrplvvtrehdyhgwtggaatvtrlrsyrsglvgensesfsaqi
    pgssynsavlmapspnmfqdsdgnllkdengellsvkytrrmienygpeqvaavitevsq
    gagsamppyeyipqirkmtkelgvlwindevltgfgrtgkwfgyqhygvqpdiitmgkgl
    sssslpagavlvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenfveqakds
    geyirsklellqekhksignfdgygllwivdivnaktktpyvkldrnfthgmnpnqiptq
    iimkkalekgvliggvmpntmrigaslnvsrgdidkamdaldyaldylesgewqalehhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g0aA (A:)
    kinweqvkewdrkylmrtfstqneyqpvpiestegdylimpdgtrlldffnqlycvnlgq
    knqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvstgseave
    talniarlytnrplvvtrehdyhgwtggaatvtrlrsyrsglvgensesfsaqipgssyn
    savlmapspnmfqdsdgnllkdengellsvkytrrmienygpeqvaavitevsqgagsam
    ppyeyipqirkmtkelgvlwindevltgfgrtgkwfgyqhygvqpdiitmgkglsssslp
    agavlvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenfveqakdsgeyirs
    klellqekhksignfdgygllwivdivnaktktpyvkldrnfthgmnpnqiptqiimkka
    lekgvliggvmpntmrigaslnvsrgdidkamdaldyaldylesgewq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5g0aB (B:)
    msltvqkinweqvkewdrkylmrtfstqneyqpvpiestegdylimpdgtrlldffnqly
    cvnlgqknqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvst
    gseavetalniarlytnrplvvtrehdyhgwtggaatvtrlrsyrsglvgensesfsaqi
    pgssynsavlmapspnmfqdsdgnllkdengellsvkytrrmienygpeqvaavitevsq
    gagsamppyeyipqirkmtkelgvlwindevltgfgrtgkwfgyqhygvqpdiitmgkgl
    sssslpagavlvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenfveqakds
    geyirsklellqekhksignfdgygllwivdivnaktktpyvkldrnfthgmnpnqiptq
    iimkkalekgvliggvmpntmrigaslnvsrgdidkamdaldyaldylesgewqalehhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g0aB (B:)
    sltvqkinweqvkewdrkylmrtfstqneyqpvpiestegdylimpdgtrlldffnqlyc
    vnlgqknqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvstg
    seavetalniarlytnrplvvtrehdyhgwtggaatvtrlrsyrsglvgensesfsaqip
    gssynsavlmapspnmfqdsdgnllkdengellsvkytrrmienygpeqvaavitevsqg
    agsamppyeyipqirkmtkelgvlwindevltgfgrtgkwfgyqhygvqpdiitmgkgls
    ssslpagavlvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenfveqakdsg
    eyirsklellqekhksignfdgygllwivdivnaktktpyvkldrnfthgmnpnqiptqi
    imkkalekgvliggvmpntmrigaslnvsrgdidkamdaldyaldylesgewq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5g0aC (C:)
    msltvqkinweqvkewdrkylmrtfstqneyqpvpiestegdylimpdgtrlldffnqly
    cvnlgqknqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvst
    gseavetalniarlytnrplvvtrehdyhgwtggaatvtrlrsyrsglvgensesfsaqi
    pgssynsavlmapspnmfqdsdgnllkdengellsvkytrrmienygpeqvaavitevsq
    gagsamppyeyipqirkmtkelgvlwindevltgfgrtgkwfgyqhygvqpdiitmgkgl
    sssslpagavlvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenfveqakds
    geyirsklellqekhksignfdgygllwivdivnaktktpyvkldrnfthgmnpnqiptq
    iimkkalekgvliggvmpntmrigaslnvsrgdidkamdaldyaldylesgewqalehhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g0aC (C:)
    kinweqvkewdrkylmrtfstqneyqpvpiestegdylimpdgtrlldffnqlycvnlgq
    knqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvstgseave
    talniarlytnrplvvtrehdyhgwtggaatvtrlrsyrsglvgensesfsaqipgssyn
    savlmapspnmfqdsdgnllkdengellsvkytrrmienygpeqvaavitevsqgagsam
    ppyeyipqirkmtkelgvlwindevltgfgrtgkwfgyqhygvqpdiitmgkglsssslp
    agavlvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenfveqakdsgeyirs
    klellqekhksignfdgygllwivdivnaktktpyvkldrnfthgmnpnqiptqiimkka
    lekgvliggvmpntmrigaslnvsrgdidkamdaldyaldylesgewq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5g0aD (D:)
    msltvqkinweqvkewdrkylmrtfstqneyqpvpiestegdylimpdgtrlldffnqly
    cvnlgqknqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvst
    gseavetalniarlytnrplvvtrehdyhgwtggaatvtrlrsyrsglvgensesfsaqi
    pgssynsavlmapspnmfqdsdgnllkdengellsvkytrrmienygpeqvaavitevsq
    gagsamppyeyipqirkmtkelgvlwindevltgfgrtgkwfgyqhygvqpdiitmgkgl
    sssslpagavlvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenfveqakds
    geyirsklellqekhksignfdgygllwivdivnaktktpyvkldrnfthgmnpnqiptq
    iimkkalekgvliggvmpntmrigaslnvsrgdidkamdaldyaldylesgewqalehhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g0aD (D:)
    sltvqkinweqvkewdrkylmrtfstqneyqpvpiestegdylimpdgtrlldffnqlyc
    vnlgqknqkvnaaikealdrygfvwdtyatdykakaakiiiedilgdedwpgkvrfvstg
    seavetalniarlytnrplvvtrehdyhgwtggaatvtrlrsyrsglvgensesfsaqip
    gssynsavlmapspnmfqdsdgnllkdengellsvkytrrmienygpeqvaavitevsqg
    agsamppyeyipqirkmtkelgvlwindevltgfgrtgkwfgyqhygvqpdiitmgkgls
    ssslpagavlvskeiaafmdkhrwesvstyaghpvamaavcanlevmmeenfveqakdsg
    eyirsklellqekhksignfdgygllwivdivnaktktpyvkldrnfthgmnpnqiptqi
    imkkalekgvliggvmpntmrigaslnvsrgdidkamdaldyaldylesgewq