PDB entry 5g08

View 5g08 on RCSB PDB site
Description: Crystal structure of Frq bound to a ligand
Class: signaling protein
Keywords: signaling protein, calcium sensor
Deposited on 2016-03-17, released 2017-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-01, with a file datestamp of 2017-02-24.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: frequenin 2
    Species: Drosophila melanogaster [TaxId:7227]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VWX8
      • engineered mutation (177)
    Domains in SCOPe 2.07: d5g08a_
  • Heterogens: CA, Z80, GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5g08A (A:)
    mgkknsklkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgd
    pskfaslvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitree
    mynivdaiyqmvgqqpqtedentpqkrvdkifdqmdknhddrltleefregskadprmvq
    alslggd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5g08A (A:)
    knsklkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgdpsk
    faslvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitreemyn
    ivdaiyqmvgqqpqtedentpqkrvdkifdqmdknhddrltleefregskadprmvqals