PDB entry 5fyi

View 5fyi on RCSB PDB site
Description: Crystal structure of human JMJD2A in complex with pyruvate
Class: oxidoreductase
Keywords: oxidoreductase, jmjd2a, kdm4a, tca intermediate
Deposited on 2016-03-07, released 2016-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-16, with a file datestamp of 2016-03-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysine-specific demethylase 4a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fyia_
  • Chain 'B':
    Compound: lysine-specific demethylase 4a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fyib_
  • Heterogens: NI, PYR, DMS, EDO, ZN, 1KA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fyiA (A:)
    mhhhhhhssgvdlgtenlyfqsmasesetlnpsarimtfyptmeefrnfsryiayiesqg
    ahraglakvvppkewkprasyddiddlvipapiqqlvtgqsglftqyniqkkamtvrefr
    kiansdkyctprysefeelerkywknltfnppiygadvngtlyekhvdewnigrlrtild
    lvekesgitiegvntpylyfgmwktsfawhtedmdlysinylhfgepkswysvppehgkr
    lerlakgffpgsaqsceaflrhkmtlisplmlkkygipfdkvtqeagefmitfpygyhag
    fnhgfncaestnfatrrwieygkqavlcscrkdmvkismdvfvrkfqperyklwkagkdn
    tvidhtlptpeaaeflkesel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fyiA (A:)
    esetlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddid
    dlvipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywk
    nltfnppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwkt
    sfawhtedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmt
    lisplmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqa
    vlcscrkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaefl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5fyiB (B:)
    mhhhhhhssgvdlgtenlyfqsmasesetlnpsarimtfyptmeefrnfsryiayiesqg
    ahraglakvvppkewkprasyddiddlvipapiqqlvtgqsglftqyniqkkamtvrefr
    kiansdkyctprysefeelerkywknltfnppiygadvngtlyekhvdewnigrlrtild
    lvekesgitiegvntpylyfgmwktsfawhtedmdlysinylhfgepkswysvppehgkr
    lerlakgffpgsaqsceaflrhkmtlisplmlkkygipfdkvtqeagefmitfpygyhag
    fnhgfncaestnfatrrwieygkqavlcscrkdmvkismdvfvrkfqperyklwkagkdn
    tvidhtlptpeaaeflkesel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fyiB (B:)
    psarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddiddlvipa
    piqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywknltfnp
    piygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwktsfawht
    edmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtlisplm
    lkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqavlcscr
    kdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaef