PDB entry 5fxp

View 5fxp on RCSB PDB site
Description: Crystal structure of eugenol oxidase in complex with vanillin
Class: oxidoreductase
Keywords: oxidoreductase, biocatalysis, selective oxidation, kinetic resolution, oxidases, eugenol
Deposited on 2016-03-02, released 2016-07-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eugenol oxidase
    Species: Rhodococcus jostii RHA1 [TaxId:101510]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5fxpa1, d5fxpa2
  • Chain 'B':
    Compound: eugenol oxidase
    Species: Rhodococcus jostii RHA1 [TaxId:101510]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5fxpb1, d5fxpb2
  • Heterogens: FAD, V55, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fxpA (A:)
    mtrtlppgvsderfdaalqrfrdvvgdkwvlstadeleafrdpypvgaaeanlpsavvsp
    esteqvqdivrianeygiplspvstgknngyggaaprlsgsvivktgermnrilevneky
    gyallepgvtyfdlyeylqshdsglmldcpdlgwgsvvgntldrgvgytpygdhfmwqtg
    levvlpqgevmrtgmgalpgsdawqlfpygfgpfpdgmftqsnlgivtkmgialmqrppa
    sqsflitfdkeedleqivdimlplrinmaplqnvpvlrnifmdaaavskrtewfdgdgpm
    paeaiermkkdldlgfwnfygtlygpppliemyygmikeafgkipgarfftheerddrgg
    hvlqdrhkinngipsldelqlldwvpngghigfspvsapdgreamkqfemvrnraneynk
    dyaaqfiiglremhhvclfiydtaipeareeilqmtkvlvreaaeagygeyrthnalmdd
    vmatfnwgdgallkfhekikdaldpngiiapgksgiwsqrfrgqnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fxpA (A:)
    trtlppgvsderfdaalqrfrdvvgdkwvlstadeleafrdpypvgaaeanlpsavvspe
    steqvqdivrianeygiplspvstgknngyggaaprlsgsvivktgermnrilevnekyg
    yallepgvtyfdlyeylqshdsglmldcpdlgwgsvvgntldrgvgytpygdhfmwqtgl
    evvlpqgevmrtgmgalpgsdawqlfpygfgpfpdgmftqsnlgivtkmgialmqrppas
    qsflitfdkeedleqivdimlplrinmaplqnvpvlrnifmdaaavskrtewfdgdgpmp
    aeaiermkkdldlgfwnfygtlygpppliemyygmikeafgkipgarfftheerddrggh
    vlqdrhkinngipsldelqlldwvpngghigfspvsapdgreamkqfemvrnraneynkd
    yaaqfiiglremhhvclfiydtaipeareeilqmtkvlvreaaeagygeyrthnalmddv
    matfnwgdgallkfhekikdaldpngiiapgksgiwsqrfrgqnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5fxpB (B:)
    mtrtlppgvsderfdaalqrfrdvvgdkwvlstadeleafrdpypvgaaeanlpsavvsp
    esteqvqdivrianeygiplspvstgknngyggaaprlsgsvivktgermnrilevneky
    gyallepgvtyfdlyeylqshdsglmldcpdlgwgsvvgntldrgvgytpygdhfmwqtg
    levvlpqgevmrtgmgalpgsdawqlfpygfgpfpdgmftqsnlgivtkmgialmqrppa
    sqsflitfdkeedleqivdimlplrinmaplqnvpvlrnifmdaaavskrtewfdgdgpm
    paeaiermkkdldlgfwnfygtlygpppliemyygmikeafgkipgarfftheerddrgg
    hvlqdrhkinngipsldelqlldwvpngghigfspvsapdgreamkqfemvrnraneynk
    dyaaqfiiglremhhvclfiydtaipeareeilqmtkvlvreaaeagygeyrthnalmdd
    vmatfnwgdgallkfhekikdaldpngiiapgksgiwsqrfrgqnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fxpB (B:)
    trtlppgvsderfdaalqrfrdvvgdkwvlstadeleafrdpypvgaaeanlpsavvspe
    steqvqdivrianeygiplspvstgknngyggaaprlsgsvivktgermnrilevnekyg
    yallepgvtyfdlyeylqshdsglmldcpdlgwgsvvgntldrgvgytpygdhfmwqtgl
    evvlpqgevmrtgmgalpgsdawqlfpygfgpfpdgmftqsnlgivtkmgialmqrppas
    qsflitfdkeedleqivdimlplrinmaplqnvpvlrnifmdaaavskrtewfdgdgpmp
    aeaiermkkdldlgfwnfygtlygpppliemyygmikeafgkipgarfftheerddrggh
    vlqdrhkinngipsldelqlldwvpngghigfspvsapdgreamkqfemvrnraneynkd
    yaaqfiiglremhhvclfiydtaipeareeilqmtkvlvreaaeagygeyrthnalmddv
    matfnwgdgallkfhekikdaldpngiiapgksgiwsqrfrgqnl