PDB entry 5fwq

View 5fwq on RCSB PDB site
Description: Apo structure of human Leukotriene A4 hydrolase
Class: hydrolase
Keywords: hydrolase, leukotriene (lt) a4 hydrolase/aminopeptidase, lta4h
Deposited on 2016-02-19, released 2016-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human leukotriene a4 hydrolase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fwqa1, d5fwqa2, d5fwqa3
  • Heterogens: ACT, ZN, YB, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fwqA (A:)
    masmtggqqmgrgsmpeivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsq
    ednlrslvldtkdltiekvvingqevkyalgerqsykgspmeislpialsknqeivieis
    fetspkssalqwltpeqtsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpke
    lvalmsairdgetpdpedpsrkiykfiqkvpipcylialvvgalesrqigprtlvwseke
    qveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyggmenpcltfvtptllag
    dkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhicgrlfgekfrhfnalgg
    wgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfallfyleqllggpeiflg
    flkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawlyspglppikpnydmtlt
    nacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrmqevyn
    fnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdkshdqav
    rtyqehkasmhpvtamlvgkdlkvdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fwqA (A:)
    vdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltiek
    vvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeqt
    sgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdped
    psrkiykfiqkvpipcylialvvgalesrqigprtlvwsekeqveksayefsetesmlki
    aedlggpyvwgqydllvlppsfpyggmenpcltfvtptllagdkslsnviaheishswtg
    nlvtnktwdhfwlneghtvylerhicgrlfgekfrhfnalggwgelqnsvktfgethpft
    klvvdltdidpdvayssvpyekgfallfyleqllggpeiflgflkayvekfsyksittdd
    wkdflysyfkdkvdvlnqvdwnawlyspglppikpnydmtltnacialsqrwitakeddl
    nsfnatdlkdlsshqlneflaqtlqraplplghikrmqevynfnainnseirfrwlrlci
    qskwedaiplalkmateqgrmkftrplfkdlaafdkshdqavrtyqehkasmhpvtamlv
    gkdlkvd