PDB entry 5fwo

View 5fwo on RCSB PDB site
Description: Llama nanobody PorM_130
Class: immune system
Keywords: immune system, type-9 secretion system (t9ss), nanobody
Deposited on 2016-02-18, released 2017-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-17, with a file datestamp of 2017-05-12.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FWO
    Domains in SCOPe 2.07: d5fwoa1, d5fwoa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fwoA (A:)
    mqvqlvesggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvtaiswsggsih
    yadsvkgrftisrdnakntvyllqmnskpedtavytcvagfagygsftsrsardsdkydy
    wgqgtkvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fwoA (A:)
    qvqlvesggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvtaiswsggsihy
    adsvkgrftisrdnakntvyllqmnskpedtavytcvagfagygsftsrsardsdkydyw
    gqgtkvtvs