PDB entry 5fvl

View 5fvl on RCSB PDB site
Description: Crystal structure of Vps4-Vps20 complex from S.cerevisiae
Class: viral protein
Keywords: viral protein, mit domain, ATPase, yeast
Deposited on 2016-02-09, released 2016-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vacuolar protein sorting-associated protein 4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52917 (1-82)
      • expression tag (0)
    Domains in SCOPe 2.08: d5fvla1, d5fvla2
  • Chain 'B':
    Compound: vacuolar protein sorting-associated protein 4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5fvlb_
  • Chain 'C':
    Compound: vacuolar protein sorting-associated protein 20
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04272 (1-End)
      • expression tag (0)
  • Chain 'D':
    Compound: vacuolar protein sorting-associated protein 20
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5fvlA (A:)
hmstgdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlirak
fteylnraeqlkkhleseeanaa

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5fvlB (B:)
hmstgdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlirak
fteylnraeqlkkhleseeanaa

    Sequence, based on observed residues (ATOM records): (download) 
    >5fvlB (B:)
gdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlirakftey
lnraeqlkkhleseeana

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.