PDB entry 5fvi

View 5fvi on RCSB PDB site
Description: Structure of IrisFP in mineral grease at 100 K.
Class: fluorescent protein
Keywords: fluorescent protein
Deposited on 2016-02-07, released 2016-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (2-224)
      • chromophore (65)
      • conflict (174)
      • conflict (192)
    Domains in SCOPe 2.07: d5fvia_
  • Chain 'B':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (2-224)
      • expression tag (0-1)
      • chromophore (65)
      • conflict (174)
      • conflict (192)
    Domains in SCOPe 2.07: d5fvib1, d5fvib2
  • Chain 'C':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (2-224)
      • expression tag (0-1)
      • chromophore (65)
      • conflict (174)
      • conflict (192)
    Domains in SCOPe 2.07: d5fvic1, d5fvic2
  • Chain 'D':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (2-224)
      • expression tag (1)
      • chromophore (65)
      • conflict (174)
      • conflict (192)
    Domains in SCOPe 2.07: d5fvid1, d5fvid2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fviA (A:)
    hhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilt
    tafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkv
    rfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttyk
    akekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fviA (A:)
    msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak
    ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fviB (B:)
    hhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilt
    tafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkv
    rfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttyk
    akekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fviC (C:)
    hhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilt
    tafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkv
    rfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttyk
    akekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5fviD (D:)
    hhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilt
    tafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkv
    rfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttyk
    akekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fviD (D:)
    hmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltt
    afhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvr
    fhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttyka
    kekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn