PDB entry 5fvb

View 5fvb on RCSB PDB site
Description: crystal structure of phormidium c-phycoerythrin at ph 5.0
Class: photosynthesis
Keywords: photosynthesis, phormidium, c-phycoerythrin, peb chromophore,
Deposited on 2016-02-05, released 2016-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-phycoerythrin alpha subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-163)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5fvba_
  • Chain 'B':
    Compound: c-phycoerythrin alpha subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-163)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5fvbb_
  • Chain 'C':
    Compound: c-phycoerythrin alpha subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-163)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5fvbc_
  • Chain 'D':
    Compound: c-phycoerythrin alpha subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-163)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5fvbd_
  • Chain 'E':
    Compound: c-phycoerythrin alpha subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-163)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5fvbe_
  • Chain 'F':
    Compound: c-phycoerythrin alpha subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-163)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5fvbf_
  • Chain 'G':
    Compound: c-phycoerythrin alpha subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-163)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5fvbg_
  • Chain 'H':
    Compound: c-phycoerythrin alpha subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-163)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5fvbh_
  • Chain 'I':
    Compound: c-phycoerythrin alpha subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-163)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5fvbi_
  • Chain 'J':
    Compound: c-phycoerythrin alpha subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-163)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5fvbj_
  • Chain 'K':
    Compound: c-phycoerythrin alpha subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-163)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5fvbk_
  • Chain 'L':
    Compound: c-phycoerythrin alpha subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-163)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5fvbl_
  • Chain 'M':
    Compound: c-phycoerythrin beta subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fvbm_
  • Chain 'N':
    Compound: c-phycoerythrin beta subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fvbn_
  • Chain 'O':
    Compound: c-phycoerythrin beta subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fvbo_
  • Chain 'P':
    Compound: c-phycoerythrin beta subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fvbp_
  • Chain 'Q':
    Compound: c-phycoerythrin beta subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fvbq_
  • Chain 'R':
    Compound: c-phycoerythrin beta subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fvbr_
  • Chain 'S':
    Compound: c-phycoerythrin beta subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fvbs_
  • Chain 'T':
    Compound: c-phycoerythrin beta subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fvbt_
  • Chain 'U':
    Compound: c-phycoerythrin beta subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fvbu_
  • Chain 'V':
    Compound: c-phycoerythrin beta subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fvbv_
  • Chain 'W':
    Compound: c-phycoerythrin beta subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fvbw_
  • Chain 'X':
    Compound: c-phycoerythrin beta subunit
    Species: PHORMIDIUM RUBIDUM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fvbx_
  • Heterogens: PEB, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbA (A:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbB (B:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbC (C:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbD (D:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbE (E:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbF (F:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbG (G:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbH (H:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbI (I:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbJ (J:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbK (K:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbL (L:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbM (M:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbN (N:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbO (O:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbP (P:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbQ (Q:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbR (R:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbS (S:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbT (T:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbU (U:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbV (V:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbW (W:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fvbX (X:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals