PDB entry 5fuq

View 5fuq on RCSB PDB site
Description: crystal structure of the h80r variant of nqo1 bound to dicoumarol
Class: oxidoreductase
Keywords: oxidoreductase, nadph-quinone oxidoreductase 1, nqo1, fad, dicoumarol
Deposited on 2016-01-29, released 2017-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nad(p)h dehydrogenase [quinone] 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15559 (0-End)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d5fuqa_
  • Chain 'B':
    Compound: nad(p)h dehydrogenase [quinone] 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15559 (0-End)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d5fuqb_
  • Heterogens: FAD, DTC, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fuqA (A:)
    mvgrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgkl
    kdpanfqypaesvlaykegrlspdivaeqkkleaadlvifqfplqwfgvpailkgwferv
    figefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfc
    gfqvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmk
    kevqdeeknkkfglsvghhlgksiptdnqikark
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fuqA (A:)
    mvgrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgkl
    kdpanfqypaesvlaykegrlspdivaeqkkleaadlvifqfplqwfgvpailkgwferv
    figefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfc
    gfqvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmk
    kevqdeeknkkfglsvghhlgksiptdnqikar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5fuqB (B:)
    mvgrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgkl
    kdpanfqypaesvlaykegrlspdivaeqkkleaadlvifqfplqwfgvpailkgwferv
    figefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfc
    gfqvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmk
    kevqdeeknkkfglsvghhlgksiptdnqikark
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fuqB (B:)
    mvgrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgkl
    kdpanfqypaesvlaykegrlspdivaeqkkleaadlvifqfplqwfgvpailkgwferv
    figefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfc
    gfqvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmk
    kevqdeeknkkfglsvghhlgksiptdnqikar