PDB entry 5fui

View 5fui on RCSB PDB site
Description: Crystal structure of the C-terminal CBM6 of LamC a marine laminarianse from Zobellia galactanivorans
Class: hydrolase
Keywords: hydrolase, carbohydrate binding module, cbm6, polysaccharide fixation, marine bacterial laminarinase, zobellia galactanivorans
Deposited on 2016-01-27, released 2016-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,3-beta-glucanase, family gh16
    Species: Zobellia galactanivorans [TaxId:63186]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5fuia_
  • Heterogens: GOL, APY, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fuiA (A:)
    hhhhhhsgntlkieaesylysndvqkepcseggenvgyinngswmsypginfpssgnyli
    eyrvasavdggrfssdleagetvlgelsvpntggwqnwttvsqtvnvsagtyqfglysis
    ggwninwiritk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fuiA (A:)
    ntlkieaesylysndvqkepcseggenvgyinngswmsypginfpssgnylieyrvasav
    dggrfssdleagetvlgelsvpntggwqnwttvsqtvnvsagtyqfglysisggwninwi
    ritk