PDB entry 5ftk

View 5ftk on RCSB PDB site
Description: Cryo-EM structure of human p97 bound to ADP
Class: hydrolase
Keywords: hydrolase, single-particle, p97, aaa ATPase
Deposited on 2016-01-14, released 2016-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-09, with a file datestamp of 2016-03-04.
Experiment type: EM
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ftka1, d5ftka2, d5ftka3, d5ftka4
  • Chain 'B':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ftkb1, d5ftkb2, d5ftkb3, d5ftkb4
  • Chain 'C':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ftkc1, d5ftkc2, d5ftkc3, d5ftkc4
  • Chain 'D':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ftkd1, d5ftkd2, d5ftkd3, d5ftkd4
  • Chain 'E':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ftke1, d5ftke2, d5ftke3, d5ftke4
  • Chain 'F':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ftkf1, d5ftkf2, d5ftkf3, d5ftkf4
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ftkA (A:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddiggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsqsnpsalretvvevpqvtwedig
    gledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfi
    sikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggnigdgggaadrv
    inqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkan
    lrkspvakdvdleflakmtngfsgadlteicqracklairesieseirrererqtnpsam
    eveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlqqsrgfgsfrfpsgnqgg
    agpsqgsgggtggsvytedndddlyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ftkA (A:)
    nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsde
    kirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfl
    eayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeeslne
    vgyddiggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
    etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
    errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
    lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
    vmnslavtmddfrwalsqsnpsalretvvevpqvtwediggledvkrelqelvqypvehp
    dkflkfgmtpskgvlfygppgcgktllakaianecqanfisikgpelltmwfgeseanvr
    eifdkarqaapcvlffdeldsiakarggnigdgggaadrvinqiltemdgmstkknvfii
    gatnrpdiidpailrpgrldqliyiplpdeksrvailkanlrkspvakdvdleflakmtn
    gfsgadlteicqracklairesieseivpeirrdhfeeamrfarrsvsdndirkyemfaq
    tlq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ftkB (B:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddiggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsqsnpsalretvvevpqvtwedig
    gledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfi
    sikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggnigdgggaadrv
    inqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkan
    lrkspvakdvdleflakmtngfsgadlteicqracklairesieseirrererqtnpsam
    eveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlqqsrgfgsfrfpsgnqgg
    agpsqgsgggtggsvytedndddlyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ftkB (B:)
    nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsde
    kirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfl
    eayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeeslne
    vgyddiggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
    etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
    errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
    lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
    vmnslavtmddfrwalsqsnpsalretvvevpqvtwediggledvkrelqelvqypvehp
    dkflkfgmtpskgvlfygppgcgktllakaianecqanfisikgpelltmwfgeseanvr
    eifdkarqaapcvlffdeldsiakarggnigdgggaadrvinqiltemdgmstkknvfii
    gatnrpdiidpailrpgrldqliyiplpdeksrvailkanlrkspvakdvdleflakmtn
    gfsgadlteicqracklairesieseivpeirrdhfeeamrfarrsvsdndirkyemfaq
    tlq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ftkC (C:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddiggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsqsnpsalretvvevpqvtwedig
    gledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfi
    sikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggnigdgggaadrv
    inqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkan
    lrkspvakdvdleflakmtngfsgadlteicqracklairesieseirrererqtnpsam
    eveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlqqsrgfgsfrfpsgnqgg
    agpsqgsgggtggsvytedndddlyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ftkC (C:)
    nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsde
    kirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfl
    eayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeeslne
    vgyddiggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
    etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
    errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
    lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
    vmnslavtmddfrwalsqsnpsalretvvevpqvtwediggledvkrelqelvqypvehp
    dkflkfgmtpskgvlfygppgcgktllakaianecqanfisikgpelltmwfgeseanvr
    eifdkarqaapcvlffdeldsiakarggnigdgggaadrvinqiltemdgmstkknvfii
    gatnrpdiidpailrpgrldqliyiplpdeksrvailkanlrkspvakdvdleflakmtn
    gfsgadlteicqracklairesieseivpeirrdhfeeamrfarrsvsdndirkyemfaq
    tlq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ftkD (D:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddiggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsqsnpsalretvvevpqvtwedig
    gledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfi
    sikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggnigdgggaadrv
    inqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkan
    lrkspvakdvdleflakmtngfsgadlteicqracklairesieseirrererqtnpsam
    eveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlqqsrgfgsfrfpsgnqgg
    agpsqgsgggtggsvytedndddlyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ftkD (D:)
    nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsde
    kirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfl
    eayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeeslne
    vgyddiggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
    etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
    errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
    lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
    vmnslavtmddfrwalsqsnpsalretvvevpqvtwediggledvkrelqelvqypvehp
    dkflkfgmtpskgvlfygppgcgktllakaianecqanfisikgpelltmwfgeseanvr
    eifdkarqaapcvlffdeldsiakarggnigdgggaadrvinqiltemdgmstkknvfii
    gatnrpdiidpailrpgrldqliyiplpdeksrvailkanlrkspvakdvdleflakmtn
    gfsgadlteicqracklairesieseivpeirrdhfeeamrfarrsvsdndirkyemfaq
    tlq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ftkE (E:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddiggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsqsnpsalretvvevpqvtwedig
    gledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfi
    sikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggnigdgggaadrv
    inqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkan
    lrkspvakdvdleflakmtngfsgadlteicqracklairesieseirrererqtnpsam
    eveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlqqsrgfgsfrfpsgnqgg
    agpsqgsgggtggsvytedndddlyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ftkE (E:)
    nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsde
    kirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfl
    eayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeeslne
    vgyddiggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
    etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
    errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
    lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
    vmnslavtmddfrwalsqsnpsalretvvevpqvtwediggledvkrelqelvqypvehp
    dkflkfgmtpskgvlfygppgcgktllakaianecqanfisikgpelltmwfgeseanvr
    eifdkarqaapcvlffdeldsiakarggnigdgggaadrvinqiltemdgmstkknvfii
    gatnrpdiidpailrpgrldqliyiplpdeksrvailkanlrkspvakdvdleflakmtn
    gfsgadlteicqracklairesieseivpeirrdhfeeamrfarrsvsdndirkyemfaq
    tlq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ftkF (F:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddiggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsqsnpsalretvvevpqvtwedig
    gledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfi
    sikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggnigdgggaadrv
    inqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkan
    lrkspvakdvdleflakmtngfsgadlteicqracklairesieseirrererqtnpsam
    eveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlqqsrgfgsfrfpsgnqgg
    agpsqgsgggtggsvytedndddlyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ftkF (F:)
    nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsde
    kirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfl
    eayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeeslne
    vgyddiggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
    etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
    errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
    lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
    vmnslavtmddfrwalsqsnpsalretvvevpqvtwediggledvkrelqelvqypvehp
    dkflkfgmtpskgvlfygppgcgktllakaianecqanfisikgpelltmwfgeseanvr
    eifdkarqaapcvlffdeldsiakarggnigdgggaadrvinqiltemdgmstkknvfii
    gatnrpdiidpailrpgrldqliyiplpdeksrvailkanlrkspvakdvdleflakmtn
    gfsgadlteicqracklairesieseivpeirrdhfeeamrfarrsvsdndirkyemfaq
    tlq