PDB entry 5fri

View 5fri on RCSB PDB site
Description: ALK5 in complex witha an N-(4-anilino-2-pyridyl)acetamide inhibitor.
Class: transferase
Keywords: transferase
Deposited on 2015-12-17, released 2016-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TGF-beta receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36897 (2-300)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5fria1, d5fria2
  • Heterogens: EDO, ZUQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5friA (A:)
    ggtiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrhe
    nilgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlh
    meivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkr
    ymapevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdps
    veemrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsq
    q