PDB entry 5fr1

View 5fr1 on RCSB PDB site
Description: Double acetylated RhoGDI-alpha in complex with RhoA-GDP
Class: signaling protein
Keywords: signaling protein, ras-superfamily, guanine-nucleotide-binding protein, molecular switch, actin-cytoskeleton rhogdi-alpha, nucleotide dissociation, prenylation, lysine-acetylation
Deposited on 2015-12-15, released 2016-01-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5fr1a_
  • Chain 'B':
    Compound: rho GDP-dissociation inhibitor 1
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5fr1b_
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fr1A (A:)
    ggsmaairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelal
    wdtagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgn
    kkdlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematra
    alqarrgkkksgclvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fr1A (A:)
    irkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtagq
    edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn
    dehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqasg
    clvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5fr1B (B:)
    hmahhhhhhmaeqeptaeqlaqiaaeneedehsvnykppaqksiqeiqeldkddeslrky
    keallgrvavsadpnvpnvvvtrltlvcstapgpleldltgdlesfkkqsfvlkegveyr
    ikisfrvnreivsgmkyiqhtyrkgvkidktdymvgsygpraeeyefltpmeeapkgmla
    rgsyniksrftdddrtdhlswewnltikkewkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fr1B (B:)
    nykppaqksiqeiqeldkddeslrkykeallvpnvvvtrltlvcstapgpleldltgdle
    sfkkqsfvlkegveyrikisfrvnreivsgmkyiqhtyrkgvkidktdymvgsygpraee
    yefltpmeeapkgmlargsyniksrftdddrtdhlswewnltikkew