PDB entry 5fqv

View 5fqv on RCSB PDB site
Description: Selective estrogen receptor downregulator antagonists: Tetrahydroisoquinoline phenols 5.
Class: signaling protein
Keywords: signaling protein, breast cancer, estrogen receptor downregulator, fulvestrant, thiq, nuclear hormone receptor
Deposited on 2015-12-14, released 2016-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372 (0-End)
      • engineered mutation (74)
      • engineered mutation (110)
      • engineered mutation (229)
    Domains in SCOPe 2.07: d5fqva_
  • Heterogens: VQI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fqvA (A:)
    alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
    fvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifd
    mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
    ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpsydlllemlda
    hrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fqvA (A:)
    alsltadqmvsalldaeppilyseydptrpfsmmglltnladrelvhminwakrvpgfvd
    ltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmll
    atssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlmak
    agltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpsydlllemld