PDB entry 5fpw

View 5fpw on RCSB PDB site
Description: proCathepsin B S9 from Trypanosoma congolense
Class: hydrolase
Keywords: hydrolase, pro cathepsin b, trypanosoma congolense, trypanosome
Deposited on 2015-12-03, released 2016-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-17, with a file datestamp of 2016-02-12.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pro cathepsin b s9
    Species: TRYPANOSOMA CONGOLENSE [TaxId:5692]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2C331
      • engineered mutation (195)
      • engineered mutation (211)
    Domains in SCOPe 2.07: d5fpwa_
  • Chain 'B':
    Compound: pro cathepsin b s9
    Species: TRYPANOSOMA CONGOLENSE [TaxId:5692]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2C331
      • engineered mutation (195)
      • engineered mutation (211)
    Domains in SCOPe 2.07: d5fpwb_
  • Chain 'C':
    Compound: pro cathepsin b s9
    Species: TRYPANOSOMA CONGOLENSE [TaxId:5692]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2C331
      • engineered mutation (195)
      • engineered mutation (211)
    Domains in SCOPe 2.07: d5fpwc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fpwA (A:)
    aefhhhhhhkdapvltktfvdrinqlnggmwkavyngkmqnitfaeakrltgawiqktss
    lppvrfteeqlrtelpesfdsaekwpncptireiadqsacraswavstasvisdryctvg
    gvqqlrisaahllscckqcgggckggfpgfawryyveygiassycqpypfphcehrgaqg
    nktpcskynfdtpkcqatctdksiplvkyrgsatylllhgeedykrelyfngpfvavfyv
    ytdlfayksgvyrhvdgdflggtavkvvgwgklngtpywkvantwdtdwgmdgyllilrg
    nnecniehlgfagtpetsqlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fpwA (A:)
    apvltktfvdrinqlnggmwkavyngkmqnitfaeakrltgawiqktsslppvrfteeql
    rtelpesfdsaekwpncptireiadqsacraswavstasvisdryctvggvqqlrisaah
    llscckqcgggckggfpgfawryyveygiassycqpypfphcenfdtpkcqatctdksip
    lvkyrgsatylllhgeedykrelyfngpfvavfyvytdlfayksgvyrhvdgdflggtav
    kvvgwgklngtpywkvantwdtdwgmdgyllilrgnnecniehlgfagtpets
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5fpwB (B:)
    aefhhhhhhkdapvltktfvdrinqlnggmwkavyngkmqnitfaeakrltgawiqktss
    lppvrfteeqlrtelpesfdsaekwpncptireiadqsacraswavstasvisdryctvg
    gvqqlrisaahllscckqcgggckggfpgfawryyveygiassycqpypfphcehrgaqg
    nktpcskynfdtpkcqatctdksiplvkyrgsatylllhgeedykrelyfngpfvavfyv
    ytdlfayksgvyrhvdgdflggtavkvvgwgklngtpywkvantwdtdwgmdgyllilrg
    nnecniehlgfagtpetsqlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fpwB (B:)
    apvltktfvdrinqlnggmwkavyngkmqnitfaeakrltgawiqktsslppvrfteeql
    rtelpesfdsaekwpncptireiadqsacraswavstasvisdryctvggvqqlrisaah
    llscckqcgggckggfpgfawryyveygiassycqpypfphcenfdtpkcqatctdksip
    lvkyrgsatylllhgeedykrelyfngpfvavfyvytdlfayksgvyrhvdgdflggtav
    kvvgwgklngtpywkvantwdtdwgmdgyllilrgnnecniehlgfagtpetsq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5fpwC (C:)
    aefhhhhhhkdapvltktfvdrinqlnggmwkavyngkmqnitfaeakrltgawiqktss
    lppvrfteeqlrtelpesfdsaekwpncptireiadqsacraswavstasvisdryctvg
    gvqqlrisaahllscckqcgggckggfpgfawryyveygiassycqpypfphcehrgaqg
    nktpcskynfdtpkcqatctdksiplvkyrgsatylllhgeedykrelyfngpfvavfyv
    ytdlfayksgvyrhvdgdflggtavkvvgwgklngtpywkvantwdtdwgmdgyllilrg
    nnecniehlgfagtpetsqlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fpwC (C:)
    apvltktfvdrinqlnggmwkavyngkmqnitfaeakrltgawiqktsslppvrfteeql
    rtelpesfdsaekwpncptireiadqsacraswavstasvisdryctvggvqqlrisaah
    llscckqcgggckggfpgfawryyveygiassycqpypfphcefdtpkcqatctdksipl
    vkyrgsatylllhgeedykrelyfngpfvavfyvytdlfayksgvyrhvdgdflggtavk
    vvgwgklngtpywkvantwdtdwgmdgyllilrgnnecniehlgfagtpetsq