PDB entry 5fpn

View 5fpn on RCSB PDB site
Description: Structure of heat shock-related 70kDA protein 2 with small-molecule ligand 3,5-dimethyl-1H-pyrazole-4-carboxylic acid (AT9084) in an alternate binding site.
Class: signaling protein
Keywords: signaling protein, heat shock, chaperone, hsp70, hspa2, protein-ligand complex, fragment screening, alternate binding site, at9084.
Deposited on 2015-12-02, released 2015-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock-related 70 kDa protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fpna1, d5fpna2
  • Chain 'B':
    Compound: Heat shock-related 70 kDa protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fpnb1, d5fpnb2
  • Heterogens: KYD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fpnA (A:)
    gshmrgpaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknq
    vamnptntifdakrligrkfedatvqsdmkhwpfrvvseggkpkvqveykgetktffpee
    issmvltkmkeiaeaylggkvhsavitvpayfndsqrqatkdagtitglnvlriinepta
    aaiaygldkkgcaggeknvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnr
    mvshlaeefkrkhkkdigpnkravrrlrtacerakrtlssstqasieidslyegvdfyts
    itrarfeelnadlfrgtlepvekalrdakldkgqiqeivlvggstripkiqkllqdffng
    kelnksinpdeavaygaavqaailigdksenvqdlllldvtplslgietaggvmtplikr
    nttiptkqtqtfttysdnqssvlvqvyegeramtkdnnllgkfdltgippaprgvpqiev
    tfdidangilnvtaadkstgkenkititndkgrlskddidrmvqeaeryksedeanrdrv
    aaknalesytynikqtvedeklrgkiseqdknkildkcqevinwldrnqmaekdeyehkq
    kelervcnpiisklyqggpgggsggggsgasggptieevd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fpnA (A:)
    gpaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
    tntifdakrligrkfedatvqsdmkhwpfrvvseggkpkvqveykgetktffpeeissmv
    ltkmkeiaeaylggkvhsavitvpayfndsqrqatkdagtitglnvlriineptaaaiay
    gldkkgcggeknvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvshla
    eefkrkhkkdigpnkravrrlrtacerakrtlssstqasieidslyegvdfytsitrarf
    eelnadlfrgtlepvekalrdakldkgqiqeivlvggstripkiqkllqdffngkelnks
    inpdeavaygaavqaailig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5fpnB (B:)
    gshmrgpaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknq
    vamnptntifdakrligrkfedatvqsdmkhwpfrvvseggkpkvqveykgetktffpee
    issmvltkmkeiaeaylggkvhsavitvpayfndsqrqatkdagtitglnvlriinepta
    aaiaygldkkgcaggeknvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnr
    mvshlaeefkrkhkkdigpnkravrrlrtacerakrtlssstqasieidslyegvdfyts
    itrarfeelnadlfrgtlepvekalrdakldkgqiqeivlvggstripkiqkllqdffng
    kelnksinpdeavaygaavqaailigdksenvqdlllldvtplslgietaggvmtplikr
    nttiptkqtqtfttysdnqssvlvqvyegeramtkdnnllgkfdltgippaprgvpqiev
    tfdidangilnvtaadkstgkenkititndkgrlskddidrmvqeaeryksedeanrdrv
    aaknalesytynikqtvedeklrgkiseqdknkildkcqevinwldrnqmaekdeyehkq
    kelervcnpiisklyqggpgggsggggsgasggptieevd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fpnB (B:)
    gpaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
    tntifdakrligrkfedatvqsdmkhwpfrvvseggkpkvqveykgetktffpeeissmv
    ltkmkeiaeaylggkvhsavitvpayfndsqrqatkdagtitglnvlriineptaaaiay
    gldkkgcggeknvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvshla
    eefkrkhkkdigpnkravrrlrtacerakrtlssstqasieidslyegvdfytsitrarf
    eelnadlfrgtlepvekalrdakldkgqiqeivlvggstripkiqkllqdffngkelnks
    inpdeavaygaavqaailig