PDB entry 5fpb

View 5fpb on RCSB PDB site
Description: Crystal structure of human KDM4D in complex with 2-1H-pyrazol-4-yloxy- 3H,4H-pyrido-3,4-d-pyrimidin-4-one
Class: oxidoreductase
Keywords: oxidoreductase, inhibitor, lysine specific histone demethylase, jmjd2d, kdm4d, jumonji
Deposited on 2015-11-27, released 2016-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-09, with a file datestamp of 2016-03-04.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine-specific demethylase 4D
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fpba_
  • Heterogens: ZN, CO, HA6, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fpbA (A:)
    ghmaqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkaretydnis
    eiliatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfedlerkywk
    nriynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpylyfgmwkt
    tfawhtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcgaflrhkva
    lisptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprwidygkma
    sqcscgearvtfsmdafvrilqperydlwkrgqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fpbA (A:)
    aqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkaretydniseil
    iatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfedlerkywknri
    ynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpylyfgmwkttfa
    whtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcgaflrhkvalis
    ptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmasqc
    scgearvtfsmdafvrilqperydlwkrgq