PDB entry 5foo

View 5foo on RCSB PDB site
Description: 6-phospho-beta-glucosidase
Class: hydrolase
Keywords: hydrolase, glycoside hydrolase, cyclophellitol, glucose 6-phosphate
Deposited on 2015-11-24, released 2016-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-02, with a file datestamp of 2016-02-26.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phospho-beta-d glycosidase
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99YP9 (0-End)
      • engineered mutation (330)
    Domains in SCOPe 2.07: d5fooa_
  • Chain 'B':
    Compound: 6-phospho-beta-d glycosidase
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99YP9 (0-End)
      • engineered mutation (330)
    Domains in SCOPe 2.07: d5foob_
  • Chain 'C':
    Compound: 6-phospho-beta-d glycosidase
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99YP9 (0-End)
      • engineered mutation (330)
    Domains in SCOPe 2.07: d5fooc_
  • Chain 'D':
    Compound: 6-phospho-beta-d glycosidase
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99YP9 (0-End)
      • engineered mutation (330)
    Domains in SCOPe 2.07: d5food_
  • Chain 'E':
    Compound: 6-phospho-beta-d glycosidase
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99YP9 (0-End)
      • engineered mutation (330)
    Domains in SCOPe 2.07: d5fooe_
  • Chain 'F':
    Compound: 6-phospho-beta-d glycosidase
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99YP9 (0-End)
      • engineered mutation (330)
    Domains in SCOPe 2.07: d5foof_
  • Heterogens: JAZ, EDO, PO4, CL, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fooA (A:)
    mlafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqies
    dltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhf
    dlpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhy
    paivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaa
    ahfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyh
    pkrvkapdaipvispswspewyydpylmpghrmnvdkgweiypeavydiaikmrdhydni
    pwflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpid
    gwswlnayknryglvennihtqvrrpkasaywfkkvathnrlislevmeefggsashlsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fooA (A:)
    mlafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqies
    dltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhf
    dlpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhy
    paivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaa
    ahfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyh
    pkrvkapdaipvispswspewyydpylmpghrmnvdkgweiypeavydiaikmrdhydni
    pwflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpid
    gwswlnayknryglvennihtqvrrpkasaywfkkvathnrli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5fooB (B:)
    mlafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqies
    dltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhf
    dlpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhy
    paivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaa
    ahfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyh
    pkrvkapdaipvispswspewyydpylmpghrmnvdkgweiypeavydiaikmrdhydni
    pwflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpid
    gwswlnayknryglvennihtqvrrpkasaywfkkvathnrlislevmeefggsashlsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fooB (B:)
    mlafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqies
    dltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhf
    dlpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhy
    paivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaa
    ahfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyh
    pkrvkapdaipvispswspewyydpylmpghrmnvdkgweiypeavydiaikmrdhydni
    pwflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpid
    gwswlnayknryglvennihtqvrrpkasaywfkkvathnrli
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5fooC (C:)
    mlafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqies
    dltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhf
    dlpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhy
    paivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaa
    ahfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyh
    pkrvkapdaipvispswspewyydpylmpghrmnvdkgweiypeavydiaikmrdhydni
    pwflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpid
    gwswlnayknryglvennihtqvrrpkasaywfkkvathnrlislevmeefggsashlsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fooC (C:)
    mlafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqies
    dltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhf
    dlpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhy
    paivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaa
    ahfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyh
    pkrvkapdaipvispswspewyydpylmpghrmnvdkgweiypeavydiaikmrdhydni
    pwflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpid
    gwswlnayknryglvennihtqvrrpkasaywfkkvathnrli
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5fooD (D:)
    mlafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqies
    dltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhf
    dlpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhy
    paivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaa
    ahfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyh
    pkrvkapdaipvispswspewyydpylmpghrmnvdkgweiypeavydiaikmrdhydni
    pwflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpid
    gwswlnayknryglvennihtqvrrpkasaywfkkvathnrlislevmeefggsashlsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fooD (D:)
    mlafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqies
    dltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhf
    dlpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhy
    paivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaa
    ahfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyh
    pkrvkapdaipvispswspewyydpylmpghrmnvdkgweiypeavydiaikmrdhydni
    pwflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpid
    gwswlnayknryglvennihtqvrrpkasaywfkkvathnrli
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5fooE (E:)
    mlafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqies
    dltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhf
    dlpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhy
    paivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaa
    ahfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyh
    pkrvkapdaipvispswspewyydpylmpghrmnvdkgweiypeavydiaikmrdhydni
    pwflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpid
    gwswlnayknryglvennihtqvrrpkasaywfkkvathnrlislevmeefggsashlsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fooE (E:)
    mlafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqies
    dltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhf
    dlpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhy
    paivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaa
    ahfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyh
    pkrvkapdaipvispswspewyydpylmpghrmnvdkgweiypeavydiaikmrdhydni
    pwflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpid
    gwswlnayknryglvennihtqvrrpkasaywfkkvathnrli
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5fooF (F:)
    mlafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqies
    dltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhf
    dlpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhy
    paivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaa
    ahfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyh
    pkrvkapdaipvispswspewyydpylmpghrmnvdkgweiypeavydiaikmrdhydni
    pwflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpid
    gwswlnayknryglvennihtqvrrpkasaywfkkvathnrlislevmeefggsashlsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fooF (F:)
    mlafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqies
    dltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhf
    dlpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhy
    paivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaa
    ahfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyh
    pkrvkapdaipvispswspewyydpylmpghrmnvdkgweiypeavydiaikmrdhydni
    pwflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpid
    gwswlnayknryglvennihtqvrrpkasaywfkkvathnrl