PDB entry 5fmo

View 5fmo on RCSB PDB site
Description: Crystal structure and proteomics analysis of empty virus like particles of Cowpea mosaic virus
Class: virus
Keywords: virus, cpmv, evlps
Deposited on 2015-11-07, released 2016-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: empty virus like particles of cowpea mosaic virus
    Species: COWPEA MOSAIC VIRUS [TaxId:12264]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fmol1, d5fmol2
  • Chain 'S':
    Compound: empty virus like particles of cowpea mosaic virus
    Species: COWPEA MOSAIC VIRUS [TaxId:12264]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5fmos_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5fmoL (L:)
    meqnlfalslddtssvrgslldtkfaqtrvllskamaggdvlldeylydvvngqdfratv
    aflrthvitgkikvtattnisdnsgcclmlainsgvrgkystdvyticsqdsmtwnpgck
    knfsftfnpnpcgdswsaemisrsrvrmtvicvsgwtlspttdviakldwsivnekcept
    iyhladcqnwlplnrwmgkltfpqgvtsevrrmplsigggagatqaflanmpnswismwr
    yfrgelhfevtkmsspyikatvtfliafgnlsdafgfyesfphrivqfaeveekctlvfs
    qqefvtawstqvnprttleadgcpylyaiihdsttgtisgdfnlgvklvgikdfcgigsn
    pgidgsrllgaiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fmoL (L:)
    meqnlfalslddtssvrgslldtkfaqtrvllskamaggdvlldeylydvvngqdfratv
    aflrthvitgkikvtattnisdnsgcclmlainsgvrgkystdvyticsqdsmtwnpgck
    knfsftfnpnpcgdswsaemisrsrvrmtvicvsgwtlspttdviakldwsivnekcept
    iyhladcqnwlplnrwmgkltfpqgvtsevrrmplsigggagatqaflanmpnswismwr
    yfrgelhfevtkmsspyikatvtfliafgnlsdafgfyesfphrivqfaeveekctlvfs
    qqefvtawstqvnprttleadgcpylyaiihdsttgtisgdfnlgvklvgikdfcgigsn
    pgidgsrllg
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >5fmoS (S:)
    gpvcaeasdvyspcmiastppapfsdvtavtfdlingkitpvgddnwnthiynppimnvl
    rtaawksgtihvqlnvrgagvkradwdgqvfvylrqsmnpesydartfvisqpgsamlnf
    sfdiigpnsgfefaespwanqttwylecvatnprqiqqfevnmrfdpnfrvagnilmppf
    plstetppllkfrfrdierskrsvmvghtataa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fmoS (S:)
    gpvcaeasdvyspcmiastppapfsdvtavtfdlingkitpvgddnwnthiynppimnvl
    rtaawksgtihvqlnvrgagvkradwdgqvfvylrqsmnpesydartfvisqpgsamlnf
    sfdiigpnsgfefaespwanqttwylecvatnprqiqqfevnmrfdpnfrvagnilmppf
    plstetppllkfrf